Produits biochimiques et réactifs

<p>Rabbit polyclonal Stefin B antibody</p>

<p>Purified recombinant IFT20 protein (His tag)</p>

<p>The IL4 antibody is a low-molecular-weight monoclonal antibody used in Life Sciences. It is designed to neutralize the effects of Interleukin 4 (IL-4), a cytokine that plays a crucial role in immune responses. By binding to IL-4, this antibody prevents its interaction with its receptors, thereby inhibiting downstream signaling pathways.</p>

<p>The CD325 antibody is a monoclonal antibody that is synthesized chemically. It belongs to the group of antibodies known as autoantibodies and has neutralizing properties. This antibody specifically targets insulin, a hormone that regulates blood sugar levels. CD325 antibody can be used for various applications in the field of life sciences, including insulin detection in human serum and research related to hyperinsulinaemic hypoglycaemia. It has been shown to have high specificity and sensitivity in recognizing insulin molecules and can be used in assays to measure insulin levels accurately. The CD325 antibody is a valuable tool for researchers studying the role of insulin in various physiological processes and diseases. Its unique properties make it an essential component in studies involving insulin and related molecules.</p>

<p>Rabbit polyclonal COMMD4 antibody (FITC)</p>

<p>KLHL1 antibody was raised in rabbit using the middle region of KLHL1 as the immunogen</p>

<p>EIF2S1 antibody was raised in mouse using recombinant Human Eukaryotic Translation Initiation Factor 2, Subunit 1 Alpha, 35Kda</p>

<p>Mouse monoclonal CAMLG antibody</p>

<p>The CD146 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to CD146, a protein expressed on the surface of various cell types. This antibody has been extensively studied and proven to be effective in numerous applications.</p>

<p>Dopamine D3 receptor antibody was raised in rabbit using a 19 amino acid peptide of human D3R as the immunogen.</p>

<p>Purified Polyclonal CDK5RAP3 antibody</p>

<p>GPR68 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal C20orf3 antibody</p>

<p>KIAA0040 antibody was raised in rabbit using the middle region of KIAA0040 as the immunogen</p>

<p>Purified Native Bordetella pertussis toxin protein</p>

<p>Mouse monoclonal TASP1 antibody</p>

<p>Flt3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal OSTLP6 antibody</p>

<p>The RPS5 antibody is a test substance used in Life Sciences research. It acts as an inhibitor of ribosomal protein synthesis, making it a valuable tool for studying the role of specific proteins in cellular processes. This polyclonal antibody can be used to detect and quantify the presence of RPS5 in various samples, such as cells or tissues. By inhibiting the function of RPS5, researchers can gain insights into its role as a biomarker or potential therapeutic target. The RPS5 antibody can be used in conjunction with other substances, such as calcium or liposomes, to further enhance its inhibitory effects. With its high specificity and sensitivity, this antibody is an essential tool for scientists working in the field of molecular biology and drug discovery.</p>

<p>Purified recombinant LAYN protein (His tag)</p>

<p>The PDLIM2 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. This antibody is specifically designed to target and bind to the PDLIM2 protein, which is an important regulator of cell growth and survival. By binding to PDLIM2, this antibody can effectively block its activity, leading to a disruption in the signaling pathways associated with cell growth and proliferation.</p>

<p>MRPS31 antibody was raised in Rabbit using Human MRPS31 as the immunogen</p>

<p>Purified recombinant MRPL1 protein (His tag)</p>

<p>Mouse monoclonal RPN10 antibody</p>

<p>Mouse monoclonal CST3 antibody</p>

<p>Purified recombinant CXADR protein (His tag)</p>

<p>Sheep polyclonal Bovine Transferrin antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPD1 antibody, catalog no. 70R-3143</p>

<p>Keratin K2 antibody was raised in mouse using Keratin K2 as the immunogen.</p>

<p>The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP) in human serum. It can be used in various applications, including research in Life Sciences and diagnostics. This antibody binds to AFP, a glycoprotein that is normally produced by the liver during fetal development but can also be present in certain types of cancer, such as hepatocellular carcinoma and germ cell tumors.</p>

<p>Mouse monoclonal GBP5 antibody</p>

<p>Rabbit polyclonal SMTNL2 antibody</p>

<p>Rabbit polyclonal CPN1 antibody</p>

<p>Mouse IgG1 antibody was raised in goat using mouse IgG1 in freunds adjuvant as the immunogen.</p>

<p>MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM</p>

<p>ANP32B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE</p>

<p>Sterile Rabbit Plasma with EDTA</p>

<p>ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPE</p>

<p>Rabbit polyclonal AEG1 antibody</p>

<p>Purified recombinant Human SERTAD1 protein (His tag)</p>

<p>ZNF529 antibody was raised in rabbit using the middle region of ZNF529 as the immunogen</p>

<p>Tetracycline antibody is a protein-based antibody that specifically targets and binds to tetracycline molecules. It is commonly used in Life Sciences research to detect and quantify the presence of tetracycline in various samples. This antibody has high affinity and specificity for tetracycline, making it a reliable tool for detecting this antibiotic.</p>

<p>Cathepsin H protein is a monoclonal antibody that interacts with chemokines and plays a crucial role in various biological processes. It is commonly used in Life Sciences research for the study of native proteins and antigens. Cathepsin H protein has been extensively studied using molecular docking techniques, which have revealed its interaction with TGF-beta, a growth factor involved in cell proliferation and differentiation. Additionally, this protein has been shown to modulate the production of interleukin-6, an important cytokine involved in immune responses. Cathepsin H protein also plays a role in collagen degradation and has been implicated in diseases such as rheumatoid arthritis. Its immobilization on surfaces, such as glycopeptide or ferritin, allows for easy detection and quantification of this protein. Furthermore, Cathepsin H protein has been associated with Helicobacter infection and may serve as a potential therapeutic target for related conditions.</p>

<p>Rat macrophage antibody was raised in rabbit using rat macrophages as the immunogen.</p>

<p>Rat monoclonal CD2 antibody (FITC)</p>

<p>SARS-CoV-2 coronavirus spike glycoprotein RBD protein</p>

<p>XK antibody was raised using a synthetic peptide corresponding to a region with amino acids QMPKNGLSEEIEKEVGQAEGKLITHRSAFSRASVIQAFLGSAPQLTLQLY</p>

<p>The Influenza B protein is a native protein and antigen that plays a crucial role in the life sciences field. It has been extensively studied for its association with various autoantibodies found in human serum. Additionally, this protein has been shown to interact with gapdh and androgen, making it an important target for research in the field of adipose biology. Monoclonal antibodies specific to the Influenza B protein have been developed, further highlighting its significance in scientific investigations. Moreover, this protein has been found to be involved in nuclear functions within adipocytes, suggesting its potential role in regulating cellular processes. With its diverse applications and interactions, the Influenza B protein continues to be a valuable tool for researchers studying various aspects of life sciences.</p>

<p>The RIN1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It belongs to the family of antibodies known as polyclonal antibodies, which are capable of recognizing and binding to multiple targets. This particular antibody has been extensively studied in the field of life sciences and has shown remarkable potential in various applications.</p>

<p>TXNDC16 antibody was raised using the N terminal of TXNDC16 corresponding to a region with amino acids EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV</p>