Produits biochimiques et réactifs

<p>Purified Polyclonal ELOF1 antibody</p>

<p>The PTGER2 antibody is an inhibitor that specifically targets the PTGER2 protein, which is involved in various cellular processes. It is commonly used as a research tool to study the function and regulation of PTGER2. This antibody has been shown to be effective in blocking the activity of PTGER2 in various assays, including chloride secretion assays and interferon-stimulated gene expression assays. Additionally, it has been used to detect the presence of PTGER2 in serum samples, making it a valuable serum marker for certain diseases. The PTGER2 antibody is a polyclonal antibody that has been extensively tested and validated for its specificity and sensitivity. Its high-flux binding capacity ensures accurate and reliable results in experimental settings. Whether you are conducting research or developing new therapeutic strategies, the PTGER2 antibody is an essential tool for studying PTGER2-related pathways and mechanisms.</p>

<p>1-131 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMCF PKVLSDDMKK LKARMHQAIE RFYDKMQNAE SGRGQVMSSL AELEDDFKEG YLETVAAYYE EQHPELTPLL EKERDGLRCR GNRSPVPDVE DPATEEPGES FCDKSYGAPR GDKEELTPQK CSEPQSSK</p>

<p>The CTLA4 antibody is a glycoprotein that acts as a kinase inhibitor. It belongs to the class of monoclonal antibodies and is commonly used in the treatment of various diseases, including cancer and autoimmune disorders. This antibody specifically targets CD20, a protein expressed on the surface of certain cells, including B lymphocytes. By binding to CD20, the CTLA4 antibody activates immune responses against these cells, leading to their destruction.</p>

<p>MORF4L2 antibody was raised in Rabbit using Human MORF4L2 as the immunogen</p>

<p>EB2 antibody was raised in Rat using Mouse EB2 fused to GST as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB4 antibody, catalog no. 70R-4586</p>

<p>C4BPA antibody was raised using the middle region of C4BPA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL</p>

<p>Mouse monoclonal UBL4A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNAI3 antibody, catalog no. 70R-9627</p>

<p>ZNF177 antibody was raised in rabbit using the N terminal of ZNF177 as the immunogen</p>

<p>ATP1B1 antibody was raised using the middle region of ATP1B1 corresponding to a region with amino acids VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Extensive research using a patch-clamp technique on human erythrocytes has demonstrated its high efficacy in human subjects. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Recombinant Human EDN3 protein (His tag)</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>Purified Polyclonal Nibrin antibody</p>

<p>Rabbit polyclonal Gag-Pol antibody (HRP)</p>

<p>1-140 amino acids: MGSSHHHHHH SSGLVPRGSH MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPIEIDM IVGKDREGFF TNGLALGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN VAVGRAGRVL VFVMGKEGVH GGGLNKKAYS MAKYLRDSGF</p>

<p>Rbm3 antibody was raised in rabbit using the N terminal of Rbm3 as the immunogen</p>

<p>Rabbit Polyclonal OR2G2 antibody</p>

<p>The ABHD2 antibody is a highly effective life sciences product that has the ability to neutralize the EGFR protein, thereby inhibiting cell proliferation. This antibody is widely used in the field of medicine and has shown promising results in various applications. It has been found to have an inhibitory effect on mesenchymal stem cells and androgen activity. The ABHD2 antibody is also known for its effectiveness in treating lymphocytic choriomeningitis and has been used in adeno-associated viral therapy. Additionally, it exhibits an antiangiogenic effect by targeting chemokine signaling pathways. With its high specificity and potency, this polyclonal antibody is a valuable tool for researchers in the life sciences field.</p>

<p>Rabbit polyclonal Chl14 antibody</p>

<p>Mouse monoclonal SulT1C2 antibody</p>

<p>Affinity purified Goat polyclonal Synphilin 1 antibody</p>

<p>HOXD13 antibody was raised in Rabbit using Human HOXD13 as the immunogen</p>

<p>TIE2 antibody was raised in rabbit using an 18 amino acid peptide from human TIE2 as the immunogen.</p>

<p>The Annexin A2 antibody is a monoclonal antibody used in Life Sciences research. It is designed to specifically target and inhibit annexin A2, a protein involved in various cellular processes. This antibody can be used in assays to study the function of annexin A2 and its role in different biological pathways. The Annexin A2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their experiments. With its high specificity and sensitivity, this antibody is a valuable tool for studying annexin A2 and its interactions with other molecules. Whether you are investigating multidrug resistance, chemokine signaling, or glucagon regulation, the Annexin A2 antibody can help advance your research in the field of Life Sciences.</p>

<p>TMEM173 antibody was raised using the middle region of TMEM173 corresponding to a region with amino acids DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL</p>

<p>MAFF antibody was raised in Rabbit using Human MAFF as the immunogen</p>

<p>Purified recombinant OXLD1 protein (His tag)</p>

<p>The POR antibody is a monoclonal antibody that is specifically designed to target and neutralize the virus surface antigen. It has been extensively tested and proven effective in human serum using mass spectrometric methods. The POR antibody works by binding to the target molecule, preventing its interaction with other cells and inhibiting its ability to cause infection. This antibody has also been shown to immobilize activated carbonic molecules, preventing their activity and reducing the risk of blood clotting. Additionally, the POR antibody has been found to have growth factor properties, promoting cell proliferation and tissue regeneration. Its high specificity and potency make it an ideal choice for therapeutic applications in anticoagulant therapy and immune-based treatments.</p>

<p>Purified recombinant Human ASF1B protein (His tag)</p>

<p>Mouse monoclonal AK4 antibody</p>

<p>Purified recombinant Human TACSTD2 protein (His tag)</p>

<p>Keratin K5/K8 (Pan Epithelial) antibody was raised in mouse using human keratin K8, purified from SDS PAGE gel as the immunogen.</p>

<p>IREB2 antibody was raised using the middle region of IREB2 corresponding to a region with amino acids IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK</p>

<p>Mouse monoclonal GDAP1L1 antibody</p>

<p>The Meloxicam antibody is a compound that exhibits inhibitory activity against serotonin. It is an antibody that specifically targets and inhibits the production of serotonin, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent for various conditions. The Meloxicam antibody is available as polyclonal antibodies, which are produced by immunizing animals with antigenic proteins. These antibodies have high specificity and affinity towards their target antigen, making them valuable tools for research and development in the field of medicine. Additionally, the Meloxicam antibody can be used in diagnostic applications to detect the presence of specific antigens or autoantibodies in biological samples. Its unique properties make it a valuable tool for researchers and healthcare professionals alike.</p>

<p>Rabbit polyclonal UBE2G2 antibody</p>

<p>CCR3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE</p>

<p>Purified recombinant ARFIP2 protein (His tag)</p>

<p>Purified recombinant FAIM protein (His tag)</p>

<p>Mouse monoclonal PRKY antibody</p>

<p>PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE</p>

<p>FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI</p>

<p>Rabbit polyclonal Collagen XII alpha 1 antibody</p>

<p>CHST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM</p>

<p>GJA3 antibody was raised in Rabbit using Human GJA3 as the immunogen</p>

<p>Purified Native Bordetella pertussis toxin protein</p>