Produits biochimiques et réactifs

<p>C16ORF48 antibody was raised using the C terminal Of C16Orf48 corresponding to a region with amino acids DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELV</p>

<p>MIF protein is a monoclonal antibody that specifically targets and neutralizes the activity of tumor necrosis factor-alpha (TNF-α). This protein has been extensively studied in the field of life sciences and is widely used in research applications. MIF protein is capable of binding to antigenic peptides and can be conjugated with other proteins for various experimental purposes. It has been shown to activate growth factors and inhibit the production of inflammatory cytokines. Additionally, MIF protein can be used in cytotoxic assays or as an electrode for polymerase chain reactions. Its inhibitory factor properties make it a valuable tool in studying angiopoietin-like 3 (ANGPTL3) and other related molecules.</p>

<p>Alkaline phosphatase antibody was raised in mouse using purified human placenta ALP as the immunogen.</p>

<p>Rabbit polyclonal WRKY62 antibody</p>

<p>Rabbit polyclonal VASH1 antibody</p>

<p>Mouse monoclonal RAD51B antibody</p>

<p>The S100P antibody is a monoclonal antibody that targets the protein S100P. S100P is a chemokine-like protein that has been implicated in various biological processes, including cell growth, differentiation, and inflammation. It is also associated with certain diseases, such as circovirus infection and cancer.</p>

<p>Mouse monoclonal C9orf41 antibody</p>

<p>Rabbit polyclonal Retinoblastoma antibody (Ser608)</p>

<p>The ALDOC antibody is a polyclonal antibody that is used in the field of Life Sciences. It specifically targets the ALDOC protein, which is involved in various cellular processes such as chemokine production, acetylation, and natriuretic regulation. This antibody can be used to study the expression and localization of ALDOC in different tissues and cell types.</p>

<p>Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL</p>

<p>ZNF415 antibody was raised in rabbit using the C terminal of ZNF415 as the immunogen</p>

<p>SLC39A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE</p>

<p>Rabbit polyclonal GPR82 antibody</p>

<p>FGF16 antibody was raised in goat using highly pure recombinant human FGF-16 as the immunogen.</p>

<p>Mouse monoclonal CHEK2 antibody</p>

<p>Mouse monoclonal LT alpha antibody</p>

<p>AP2A1 antibody was raised in rabbit using the C terminal of AP2A1 as the immunogen</p>

<p>KHDRBS1 antibody was raised using the middle region of KHDRBS1 corresponding to a region with amino acids PPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSY</p>

<p>SH2B1 antibody was raised using the middle region of SH2B1 corresponding to a region with amino acids GTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSD</p>

<p>Rat monoclonal CD11a antibody (PE)</p>

<p>mTORC1/2 inhibitor</p>

<p>Rat monoclonal CD49f antibody (biotin)</p>

<p>Rabbit polyclonal Caspase 9 antibody (Thr125)</p>

<p>CK2 alpha antibody was raised using the C terminal of CSNK2A2 corresponding to a region with amino acids GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD</p>

<p>Mouse monoclonal UBE2E3 antibody</p>

<p>RAD17 antibody was raised in rabbit using residues 2-15 [NQVTDWVDPSFDDF] of the human RAD17 protein as the immunogen.</p>

<p>Rabbit polyclonal STX8 antibody</p>

<p>Rabbit polyclonal ABL1 antibody (Thr735)</p>

<p>Mouse monoclonal NLN antibody</p>

<p>MCM8 antibody was raised in Rabbit using Human MCM8 as the immunogen</p>

<p>PRMT6 antibody was raised in Mouse using a purified recombinant fragment of human PRMT6 expressed in E. coli as the immunogen.</p>

<p>IL11 antibody was raised in Mouse using recombinant human IL-11 as the immunogen.</p>

<p>EARS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL</p>

<p>REEP4 antibody was raised using the N terminal of REEP4 corresponding to a region with amino acids EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE</p>

<p>Rabbit polyclonal TBPL1 antibody</p>

<p>ITLN1 antibody was raised in Rabbit using Human ITLN1 as the immunogen</p>

<p>The Hepatitis C Virus protein is a versatile and crucial component in the field of Life Sciences. It plays a significant role in various biological processes, including cell growth, differentiation, and immune response. This protein has been extensively studied for its interactions with other molecules and its impact on human health.</p>

<p>Rat RBC antibody was raised in rabbit using rat erythrocytes as the immunogen.</p>

<p>RPESP antibody was raised using the C terminal of RPESP corresponding to a region with amino acids WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC</p>

<p>GIMAP2 antibody was raised in Rabbit using Human GIMAP2 as the immunogen</p>

<p>GLS antibody was raised in Rabbit using Human GLS as the immunogen</p>

<p>Mouse monoclonal NXNL2 antibody</p>

<p>The AID antibody is a monoclonal antibody that has neutralizing properties and specifically targets the HER2 receptor. This antibody binds to the amino group of the HER2 growth factor and inhibits its activity. It can be used in various applications, such as immunohistochemistry, western blotting, and ELISA assays. The AID antibody has been extensively studied in the field of life sciences and has shown promising results in inhibiting tumor growth. It can also be used in combination with other antibodies, such as trastuzumab, to enhance its therapeutic effects. Additionally, this antibody has been shown to have interferon-like activity and can modulate gene expression in nuclear extracts. With its lysine-specific binding capabilities, the AID antibody offers researchers a valuable tool for studying epidermal growth factor signaling pathways and understanding their role in various cellular processes.</p>

<p>Rabbit polyclonal RPL19 antibody</p>

<p>Purified Polyclonal Cotinine 3 Antibody</p>

<p>NET antibody was raised in rabbit using a 22 amino acid peptide of rat NET as the immunogen.</p>

<p>The HOXB4 antibody is a highly specialized monoclonal antibody that acts as an inhibitor of the HOXB4 protein. This protein plays a crucial role in the regulation of hematopoietic stem cell proliferation and differentiation. By targeting and neutralizing the HOXB4 protein, this antibody effectively inhibits its cytotoxic effects and prevents the activation of downstream signaling pathways.</p>

<p>The SOCS3 antibody is a glycoprotein that belongs to the family of antibodies. It is specifically designed to target and bind to a specific antigen, which can be used for various applications in the Life Sciences field. The SOCS3 antibody is a monoclonal antibody, meaning it is produced by a single type of immune cell and has high specificity for its target antigen.</p>

<p>Mouse monoclonal GAS7 antibody</p>