Produits biochimiques et réactifs

<p>Rabbit polyclonal SNAP29 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STK32A antibody, catalog no. 70R-3604</p>

<p>ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH</p>

<p>ERCC6L antibody was raised using the N terminal Of Ercc6L corresponding to a region with amino acids GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RDBP antibody, catalog no. 70R-4630</p>

<p>LENG9 antibody was raised in Rabbit using Human LENG9 as the immunogen</p>

<p>Rabbit polyclonal Tau antibody (Ser519/202)</p>

<p>HK1 antibody was raised in rabbit using the N terminal of HK1 as the immunogen</p>

<p>Also known as Protein Kinase B (PKB), Akt is a signaling protein in cells that regulates important processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth. This pathway is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. Akt can then influence downstream processes, inhibiting apoptosis to promote cell survival, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism.Akt plays a key role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.</p>

<p>UCP1 antibody was raised in rabbit using a 12 amino acid peptide from mouse/rat UCP1 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DRAM antibody, catalog no. 70R-9619</p>

<p>The SLIT2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It targets the mitogen-activated protein SLIT2, which plays a crucial role in cell growth and development. This antibody has been shown to inhibit the activity of SLIT2, making it an invaluable tool for studying the function of this growth factor.</p>

<p>Purified recombinant ZWINT protein (His tag)</p>

<p>GPR161 antibody was raised in Rabbit using Human GPR161 as the immunogen</p>

<p>Rabbit polyclonal PSMB11 antibody</p>

<p>The PYK2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the activity of the colony-stimulating factor (CSF) receptor known as PYK2. This antibody has been extensively tested and proven to effectively bind to PYK2, inhibiting its receptor binding and downstream signaling pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM126A antibody, catalog no. 70R-10016</p>

<p>FAM119A antibody was raised using the middle region of FAM119A corresponding to a region with amino acids LGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVK</p>

<p>The GluR1 antibody is a polyclonal antibody that is used in Life Sciences research. It has been specifically designed to detect and bind to the GluR1 receptor, which is an ionotropic glutamate receptor involved in synaptic transmission. This antibody can be used in various applications, such as electrochemical impedance spectroscopy and transcription-polymerase chain reaction (PCR), to study the function and expression of the GluR1 receptor. Additionally, it can be used in agglutination assays to measure the interaction between the GluR1 receptor and other molecules, such as glycine or gamma-aminobutyric acid (GABA). The GluR1 antibody has high specificity and affinity for its target, making it a valuable tool for researchers studying neuronal signaling pathways and synaptic plasticity. Furthermore, this antibody has shown antioxidant activity and may have potential therapeutic applications in neurodegenerative diseases.</p>

<p>Avidin antibody (biotin) was raised in rabbit using avidin isolated from hen egg white as the immunogen.</p>

<p>Rabbit polyclonal Guanylate Cyclase beta antibody</p>

<p>The Methylprednisolone antibody is a monoclonal antibody that falls under the category of Life Sciences. This hormone peptide antibody specifically targets and binds to methylprednisolone, a steroid hormone. It has a glycan structure that plays a crucial role in neutralizing the effects of methylprednisolone.</p>

<p>Rabbit polyclonal NGAL antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPB2 antibody, catalog no. 70R-5364</p>

<p>ZNF488 antibody was raised in rabbit using the C terminal of ZNF488 as the immunogen</p>

<p>Purified recombinant SEMG1 protein (His tag)</p>

<p>ZNF674 antibody was raised in rabbit using the N terminal of ZNF674 as the immunogen</p>

<p>ATP11B antibody was raised using the N terminal of ATP11B corresponding to a region with amino acids DIVRIAKDEIFPADLVLLSSDRLDGSCHVTTASLDGETNLKTHVAVPETA</p>

<p>Factor X antibody was raised in goat using human Factor X purified from plasma as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SOHLH2 antibody, catalog no. 70R-8335</p>

<p>DNM2 antibody was raised in Rabbit using Human DNM2 as the immunogen</p>

<p>RNASEH2A antibody was raised using the middle region of RNASEH2A corresponding to a region with amino acids AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE</p>

<p>The TIMP1 monoclonal antibody is a highly specialized antibody that specifically targets and neutralizes the activity of tissue inhibitor of metalloproteinase 1 (TIMP1). TIMP1 is a protein involved in various biological processes, including dopamine regulation, adiponectin signaling, and chemokine activity.</p>

<p>NAMPT antibody was raised in Rabbit using Human NAMPT as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing the growth of bacteria. Its efficacy has been demonstrated through extensive research using advanced techniques like the patch-clamp technique on human erythrocytes. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>INSIG2 antibody was raised using the N terminal of INSIG2 corresponding to a region with amino acids MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Tmem110 antibody, catalog no. 70R-9362</p>

<p>PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL</p>

<p>Affinity purified Rabbit polyclonal TMLHE antibody</p>

<p>Purified Rabbit polyclonal Calsenilin antibody (Ser63)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RIT1 antibody, catalog no. 70R-10368</p>

<p>HRP Conjugated Chicken anti-Heartworm Antibody</p>

<p>Purified recombinant PDCD1LG2 protein (His tag)</p>

<p>anti-Calmodulin Binding Peptide Antibody</p>

<p>anti-DYKDDDDK Antibody</p>

<p>FITC Conjugated Rabbit anti-V5 Tag Antibody</p>

<p>anti-DYKDDDDK Antibody</p>

<p>HRP Conjugated Rabbit anti-Plasmodium aldolase Antibody</p>

<p>Bnc1 antibody was raised in rabbit using the C terminal of Bnc1 as the immunogen</p>