Produits biochimiques et réactifs

<p>Recombinant Human Kallikrein 2 Protein</p>

<p>The SYK antibody is a polyclonal antibody that has cytotoxic effects on cancer cells. It specifically targets the plasminogen activator receptor (uPAR), alpha-fetoprotein (AFP), and other antigens involved in cancer cell growth and metastasis. This antibody can be used in life sciences research to study the role of these proteins in cancer development and progression. Additionally, it has potential as a therapeutic agent for the treatment of multidrug-resistant cancers. The SYK antibody can also be used in diagnostic applications, such as detecting the presence of specific antigens in patient samples. With its versatile applications and high specificity, this antibody is a valuable tool for researchers and clinicians working in the field of cancer biology.</p>

<p>Rabbit polyclonal Spa17 antibody (biotin)</p>

<p>This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.</p>

<p>RPL18 antibody was raised using the N terminal of RPL18 corresponding to a region with amino acids MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR</p>

<p>Rabbit polyclonal ATP5G2 antibody</p>

<p>C19ORF47 antibody was raised using the middle region of C19Orf47 corresponding to a region with amino acids YVINMPKGTTPRTRKILEQQQAAKGLHRTSVFDRLGAETKADTTTGSKPT</p>

<p>The Cytokeratin 8 antibody is a highly effective diagnostic reagent used in various research and medical applications. It is an activated antibody that specifically targets catecholaminergic neurons, making it ideal for studying the function and characteristics of these cells.</p>

<p>Rabbit polyclonal SLC38A4 antibody</p>

<p>KLHL22 antibody was raised in Mouse using a purified recombinant fragment of human KLHL22 expressed in E. coli as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Mouse monoclonal SERPINB4 antibody</p>

<p>Recombinant Human BRAF protein (His tag)</p>

<p>Purified Polyclonal mGLUR6 antibody</p>

<p>Rabbit polyclonal CDK7 antibody (Thr170)</p>

<p>The CPE antibody is a life sciences product that serves as a serum marker for various applications. This antibody specifically targets and binds to the protein known as CPE (carboxypeptidase E), which plays a crucial role in several biological processes. With its high specificity and affinity, the CPE antibody can be used in research, diagnostics, and therapeutics.</p>

<p>Chlamydia trachomatis antibody was raised in rabbit using L2 and other serovar groups as the immunogen.</p>

<p>LILRA5 antibody was raised in Rabbit using Human LILRA5 as the immunogen</p>

<p>The TIMP3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets epidermal growth factor and has been widely used in studies related to alpha-fetoprotein, histidine, globulin, and mesenchymal stem cells. The TIMP3 antibody has shown neutralizing properties against caspase-9 and acts as a growth factor family kinase inhibitor. It is formulated with excipients to ensure stability and efficacy. This antibody is highly sought after by researchers in the field for its specificity and reliability in various applications.</p>

<p>The PFKP antibody is a monoclonal antibody used in Life Sciences research. It has various applications, including the study of nonsteroidal anti-inflammatory drugs and growth factors. This antibody can be used as a selectable marker in cytometry analysis and is particularly useful in the study of pluripotent stem cells. The PFKP antibody is highly specific and can be used for various techniques such as polymerase chain reaction (PCR) and immunoprecipitation with nuclear extracts. Additionally, this antibody has been shown to have an effect on epidermal growth factor-induced apoptosis. Its high specificity makes it an essential tool for researchers studying antibodies, monoclonal antibodies, and even oncolytic adenoviruses.</p>

<p>MAK16 antibody was raised in Rabbit using Human MAK16 as the immunogen</p>

<p>Mouse monoclonal GSTO2 antibody</p>

<p>The LOX antibody is a reactive monoclonal antibody that is activated through chromatographic techniques. It is specifically designed to target and bind to LOX, a chemokine involved in various cellular processes. This antibody has been extensively used in research studies, such as Western blotting and immunohistochemistry, to detect the presence and localization of LOX in different tissues and cell types. Additionally, the LOX antibody has shown promising results in multidrug resistance studies, particularly in cardiomyocytes where it inhibits the efflux of anticancer drugs. Furthermore, this monoclonal antibody has demonstrated its potential therapeutic applications in regulating glucagon secretion and modulating polyunsaturated fatty acid metabolism. With its high specificity and affinity, the LOX antibody is an invaluable tool for researchers in the life sciences field.</p>

<p>Rabbit polyclonal ARHGDIA antibody</p>

<p>NEIL2 antibody was raised in mouse using recombinant Human Nei Like 2 (E. Coli)</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>Sheep polyclonal Tramadol N antibody</p>

<p>Purified Polyclonal CK1 gamma 3 antibody</p>

<p>ZNF415 antibody was raised in rabbit using the N terminal of ZNF415 as the immunogen</p>

<p>DISP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV</p>

<p>The CLPP antibody is a monoclonal antibody that targets collagen, a crucial component in the growth and development of various tissues. This antibody has been extensively studied for its potential therapeutic applications in promoting the growth and differentiation of mesenchymal stem cells. It works by binding to specific receptors on the surface of these cells, triggering a series of signaling events that promote cell proliferation and tissue regeneration.</p>

<p>Purified recombinant GOLGA7 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANGPT4 antibody, catalog no. 70R-5269</p>

<p>ADRA2C antibody was raised in rabbit using a synthetic peptide comprising internal residues of the human Alpha 2c protein as the immunogen.</p>

<p>Purified Polyclonal CRABP2 antibody</p>

<p>Rabbit polyclonal USP32 antibody</p>

<p>Donkey anti-guinea pig IgG (H + L) (Cy3) was raised in donkey using guinea pig IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal TAF9 antibody</p>

<p>Purified recombinant Mouse LGALS3 protein</p>

<p>Purified recombinant IFNL2 protein (His tag)</p>

<p>C1ORF75 antibody was raised using the N terminal Of C1Orf75 corresponding to a region with amino acids IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP</p>

<p>Rabbit polyclonal VAMP5 antibody</p>

<p>The ACSS2 antibody is a powerful tool in the field of life sciences. It specifically targets and detects TGF-beta, alpha-fetoprotein, and phosphatase-activated adenosine triphosphate. This monoclonal antibody is widely used for immunohistochemical detection in various research applications.</p>

<p>LZTS2 antibody was raised using the N terminal of LZTS2 corresponding to a region with amino acids EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL</p>

<p>Goat anti-rat IgG (Fab'2) was raised in goat using rat IgG F(c) fragment as the immunogen.</p>

<p>The Chk2 antibody is a potent inhibitor of the catechol-O-methyltransferase (COMT) family kinase. It has been shown to induce necrosis factor-related apoptosis-inducing ligand (TRAIL)-mediated cell death in cancer cells. This antibody specifically targets the circumsporozoite protein, which is expressed on the surface of Plasmodium falciparum, the parasite that causes malaria. The Chk2 antibody is available as both monoclonal and polyclonal antibodies, making it a versatile tool for researchers studying various biological processes. Its cytotoxic properties make it an ideal candidate for targeted therapies against cancer, while its nuclear localization allows for efficient detection and analysis in immunofluorescence experiments.</p>

<p>Purified recombinant GULP1 protein (His tag)</p>

<p>Purified Polyclonal Cytochrome P450 2A7 antibody</p>

<p>Insulin-Like Growth Factor Monoclonal Antibody (HRP)</p>

<p>FXYD7 antibody was raised using the N terminal of FXYD7 corresponding to a region with amino acids MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK</p>