Produits biochimiques et réactifs

<p>ACTR10 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL</p>

<p>Sheep polyclonal Epitestosterone antibody</p>

<p>Purified Polyclonal B4GALT3 antibody</p>

<p>CTR9 antibody was raised in Rabbit using Human CTR9 as the immunogen</p>

<p>SLC5A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR</p>

<p>Diclazuril Conjugate for use in immunoassays</p>

<p>The PTBP1 antibody is a monoclonal antibody that specifically targets and inhibits the function of PTBP1, a protein involved in various cellular processes. This antibody can be used as a research tool to study the role of PTBP1 in different biological systems. It is also useful for developing inhibitors or therapeutic antibodies targeting PTBP1 for potential clinical applications. The PTBP1 antibody is widely used in life sciences research, including studies on growth factors, oncogenic kinases, and binding proteins. Its high affinity and specificity make it an ideal tool for experiments involving immobilization on electrodes or other surfaces. By blocking the activity of PTBP1, this antibody can help uncover new insights into the regulation of cellular processes and potentially lead to the development of novel therapies targeting PTBP1-related diseases.</p>

<p>CD19 antibody was raised in Mouse using a purified recombinant fragment of human CD19 expressed in E. coli as the immunogen.</p>

<p>BDNF protein is a biomolecule that plays a crucial role in various biological processes. It is commonly used in life sciences research and is available as a recombinant protein. BDNF protein interacts with actin filaments and other cellular components to regulate cell growth, survival, and synaptic plasticity. This protein can be detected using specific monoclonal antibodies or anti-DNP antibodies. BDNF protein is also known to interact with epidermal growth factor (EGF) and other growth factors, making it an important player in cell signaling pathways. Researchers often use BDNF protein inhibitors to study its function and potential therapeutic applications. This product is suitable for use in various experimental setups, including assays involving human serum samples. With its high purity and colloidal properties, BDNF protein offers researchers a reliable tool for their studies in the field of proteins and antigens.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OXSM antibody, catalog no. 70R-2413</p>

<p>ZNF21 antibody was raised in rabbit using the middle region of ZNF21 as the immunogen</p>

<p>Rabbit polyclonal CCL22 antibody (biotin)</p>

<p>Rabbit polyclonal RXRG antibody</p>

<p>The CD200R antibody is a highly specialized antibody that is used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and has been specifically designed to target CD200R, which is a cell surface receptor involved in immune regulation. This antibody can be used for various applications, including the detection and quantification of CD200R expression in different tissues or cell types.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GC antibody, catalog no. 70R-10253</p>

<p>Rabbit polyclonal KAD1 antibody</p>

<p>Feline Serum Amyloid A, Recombinant</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX1 antibody, catalog no. 70R-1397</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HSH2D antibody, catalog no. 70R-10150</p>

<p>Rabbit polyclonal PKIG antibody</p>

<p>Rabbit polyclonal Kininogen 1 antibody (FITC)</p>

<p>Purified native Human TSH alpha protein</p>

<p>ACSL1 antibody was raised using the N terminal of ACSL1 corresponding to a region with amino acids ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY</p>

<p>IFN alpha antibody was raised in rabbit using mouse interferon alpha as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CARS antibody, catalog no. 70R-4848</p>

<p>TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI</p>

<p>SLC35F2 antibody was raised using the N terminal of SLC35F2 corresponding to a region with amino acids MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS</p>

<p>LOC100364462 antibody was raised in rabbit using the middle region of LOC100364462 as the immunogen</p>

<p>CYTH2 antibody was raised in Rabbit using Human CYTH2 as the immunogen</p>

<p>Purified Rabbit polyclonal GRB10 antibody (Tyr67)</p>

<p>MAX antibody was raised in rabbit using the middle region of MAX as the immunogen</p>

<p>Purified Polyclonal COL26A1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BCAS2 antibody, catalog no. 70R-4719</p>

<p>CYP27A1 antibody was raised using the middle region of CYP27A1 corresponding to a region with amino acids SRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A35 antibody, catalog no. 70R-6514</p>

<p>EFNB1 antibody was raised in Rabbit using Human EFNB1 as the immunogen</p>

<p>NEDD4 antibody was raised using the middle region of NEDD4 corresponding to a region with amino acids SRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRT</p>

<p>SERPINI2 antibody was raised in rabbit using the middle region of SERPINI2 as the immunogen</p>

<p>Rabbit Ig fraction control or blocking reagent</p>

<p>Rabbit Polyclonal Stathmin 1 antibody (Ser37)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIP1 antibody, catalog no. 70R-4677</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB26 antibody, catalog no. 70R-8355</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC732440 antibody, catalog no. 70R-9043</p>

<p>The GLB1 antibody is a trifunctional antibody that is used in bioassays and research in the field of Life Sciences. It has been shown to be effective in neutralizing the activity of human serum, particularly against chemokines. The GLB1 antibody also targets tyrosine kinase receptors and has been used in studies involving alpha-fetoprotein and anti-beta amyloid antibodies. Additionally, this antibody has been found to have genotoxic effects and can inhibit the activity of 3-kinase enzymes. Its versatility and specificity make it a valuable tool for researchers in various fields.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Rabbit polyclonal AFG3L2 antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYT9 antibody, catalog no. 70R-7051</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRP19 antibody, catalog no. 70R-1410</p>

<p>Rabbit polyclonal DARP32 antibody (Thr75)</p>

<p>Purified recombinant MEOX2 protein (His tag)</p>