Produits biochimiques et réactifs

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TAAR5 antibody, catalog no. 70R-9832</p>

<p>DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT</p>

<p>The GAPDH antibody is a highly specialized monoclonal antibody that targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) protein. This cysteine-rich protein plays a crucial role in various cellular processes, including glycolysis and energy metabolism. Additionally, GAPDH has been identified as an angiogenic inducer and an activated growth factor.</p>

<p>Rabbit polyclonal CCL2 antibody (biotin)</p>

<p>Rabbit polyclonal PWP2 antibody</p>

<p>Mouse monoclonal PCNA antibody (Prediluted for IHC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TP53BP2 antibody, catalog no. 70R-8271</p>

<p>NR2E1 antibody was raised using the middle region of NR2E1 corresponding to a region with amino acids LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL</p>

<p>Mouse monoclonal gp64 antibody (allophycocyanin)</p>

<p>SECTM1 antibody was raised using the middle region of SECTM1 corresponding to a region with amino acids ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV</p>

<p>Akt, also called Protein Kinase B (PKB), is a serine/threonine-specific protein kinase crucial for regulating cellular functions such as growth, survival, metabolism, and proliferation. It serves as a central component in the PI3K/Akt/mTOR pathway, integrating signals required for cellular adaptation and function. Humans express three primary isoforms of Akt—Akt1, Akt2, and Akt3—each encoded by different genes. Activation of Akt starts when external signals, like growth factors or insulin, bind to cell surface receptors, which then activate phosphoinositide 3-kinase (PI3K). This cascade leads to the formation of PIP3 on the cell membrane, recruiting Akt to undergo two key phosphorylation events at Thr308 and Ser473. Once activated, Akt can travel within the cell to phosphorylate target proteins.The main functions of Akt include enhancing cell survival by blocking apoptosis through the inactivation of pro-apoptotic proteins such as BAD and Caspase-9, and promoting cell growth and proliferation by activating mTOR, a critical regulator of protein synthesis. Akt also plays a central role in metabolism, boosting glucose uptake and glycolysis through GLUT4 translocation and hexokinase activation, which is especially important in muscle and fat tissues. Additionally, Akt facilitates angiogenesis by upregulating VEGF, supporting tissue repair, and enhances cell migration, assisting in wound healing but also enabling the spread of cancer cells. Given its broad role in supporting cell growth and survival, Akt is frequently hyperactivated in cancers, fueling unchecked cell division and tumor development, which makes it a target in cancer treatments. Furthermore, Akt’s role in glucose metabolism connects it to insulin signaling, where pathway disruptions can lead to impaired glucose uptake, contributing to insulin resistance and type 2 diabetes.</p>

<p>TCTN3 antibody was raised using the middle region of TCTN3 corresponding to a region with amino acids LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS</p>

<p>The BLM antibody is a monoclonal antibody that is widely used in Life Sciences research. It has the ability to lyse cells and neutralize the effects of certain proteins, such as collagen and tumor necrosis factor-alpha (TNF-α). This antibody can also be used to study the role of growth factors and other antibodies, such as polyclonal antibodies, trastuzumab, and adalimumab. Additionally, it has been shown to interact with various molecules, including TGF-beta, chemokines, and epidermal growth factors. The BLM antibody is a valuable tool for researchers in various fields who are interested in studying protein interactions and their effects on cellular processes.</p>

<p>Recombinant Human Troponin I protein (Cardiac)</p>

<p>Rabbit polyclonal MRPS24 antibody</p>

<p>CYP2S1 antibody was raised in rabbit using the C terminal of CYP2S1 as the immunogen</p>

<p>The ACTB antibody is a highly specialized monoclonal antibody that targets the ACTB protein. This protein plays a crucial role in various biological processes, including cell structure and movement. The ACTB antibody specifically recognizes and binds to the ACTB protein, allowing for its detection and analysis in various experimental settings.</p>

<p>Mouse monoclonal CD80 antibody (biotin)</p>

<p>The KRT14 antibody is a growth factor that plays a crucial role in various biological processes. It is an autoantibody that specifically targets and activates KRT14, which is a multidrug resistance protein. This antibody has shown promising results in combination with other therapies such as trastuzumab, leading to increased efficacy in the treatment of certain cancers. Additionally, the KRT14 antibody has been found to reduce viscosity and enhance drug delivery due to its ability to bind to amino groups and inhibit interleukin-6 activity. This monoclonal antibody offers a targeted approach for treating diseases associated with KRT14 dysregulation, making it a valuable tool in medical research and therapy development.</p>

<p>The CD20 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the CD20 protein, which is found on the surface of activated B cells. This antibody has a unique structure with an EGF-like domain and is engineered for high specificity and affinity.</p>

<p>Rabbit polyclonal S100B antibody (HRP)</p>

<p>PIGW antibody was raised using the middle region of PIGW corresponding to a region with amino acids IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV</p>

<p>The STAT5A antibody is a highly specialized monoclonal antibody that has neutralizing properties against activated tissue transglutaminase. It is commonly used in Life Sciences research to study the matrix metalloproteinase pathway and its role in various cellular processes. This cytotoxic antibody binds specifically to collagen and fibronectin, inhibiting their interaction with other molecules and preventing cell adhesion and migration. The STAT5A antibody has also been shown to inhibit the production of pro-inflammatory cytokines such as TNF-α and chemokines, thereby reducing inflammation. It does not contain any excipients or natriuretic substances, making it safe for use in laboratory experiments. Researchers rely on the STAT5A antibody for its high specificity and potency in studying cellular signaling pathways and developing potential therapeutic interventions.</p>

<p>The SMAD3 antibody is a monoclonal antibody that specifically targets SMAD3, a protein involved in cell signaling pathways. This antibody has been extensively studied and proven to be effective in various research applications within the Life Sciences field.</p>

<p>A4GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE</p>

<p>The gamma delta TCR antibody is a monoclonal antibody that specifically targets the gamma delta T-cell receptor (TCR). It has been shown to have antiangiogenic properties and can inhibit the growth of endothelial cells. This antibody is highly specific and has been extensively tested for its efficacy in various research studies. It can be used in experiments involving nuclear extracts, electrode assays, and human serum samples. The gamma delta TCR antibody is also known for its ability to block the activation of serine proteases and inhibit the production of erythropoietin. Additionally, it has been shown to have low density lipoprotein (LDL) receptor activity and can modulate the activity of growth factors. With its unique characteristics, this monoclonal antibody is a valuable tool for researchers studying T-cell biology and related fields.</p>

<p>IER5 antibody was raised using the N terminal of IER5 corresponding to a region with amino acids MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD</p>

<p>The RAMP2 antibody is a highly specialized product used in Life Sciences research. It is an essential tool for scientists studying various biological processes and pathways. This antibody is designed to specifically bind to RAMP2, which stands for receptor activity-modifying protein 2. RAMP2 plays a crucial role in mediating the actions of vasoactive intestinal peptide (VIP), calcitonin gene-related peptide (CGRP), and adrenomedullin (AM). The RAMP2 antibody has been extensively tested and validated for its high affinity and specificity in recognizing RAMP2.</p>

<p>Rabbit polyclonal OR4D1 antibody</p>

<p>Rabbit polyclonal SMC1 antibody (Ser957)</p>

<p>Rabbit polyclonal MUC1 antibody (Tyr1229)</p>

<p>Purified Polyclonal TESK2 antibody</p>

<p>Rabbit polyclonal OTUB1 antibody (HRP)</p>

<p>SERPINE1 antibody was raised using the C terminal of SERPINE1 corresponding to a region with amino acids VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM</p>

<p>The HDAC6 antibody is a highly effective inhibitor used in Life Sciences research. It has been shown to exhibit strong binding affinity and specificity for HDAC6, a nuclear enzyme involved in the regulation of gene expression. This antibody can be used for various applications, including electrochemical impedance assays, detection of autoantibodies in human serum, and studying the role of HDAC6 in growth factor signaling pathways. Additionally, it has been found to modulate the activity of vasoactive intestinal peptide (VIP), a neuropeptide with important physiological functions. The HDAC6 antibody is immobilized on a solid support and can be easily used for protein purification or detection purposes. With its high sensitivity and selectivity, this monoclonal antibody is an invaluable tool for researchers in the field of Life Sciences.</p>

<p>The MEF2C antibody is a highly specialized product used in the field of Life Sciences for immunoassays. It is designed to specifically target and bind to the glucagon hormone. This antibody is produced using advanced techniques, resulting in a high-quality product with exceptional specificity and sensitivity.</p>

<p>The APP antibody is a highly effective tool in the field of Life Sciences. It is a Monoclonal Antibody that specifically targets and interacts with the Amyloid Precursor Protein (APP), a key player in various biological processes. The APP antibody is widely used in research to study the antigen-antibody reaction and its implications in different cellular pathways.</p>

<p>CHRAC1 antibody was raised in rabbit using the middle region of CHRAC1 as the immunogen</p>

<p>Purified Rabbit polyclonal OR2M2 antibody</p>

<p>Keratin K18 Multiepitope antibody was raised in mouse using Keratin K18 of human and bovine origin as the immunogen.</p>

<p>RHBDF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR</p>

<p>Mouse monoclonal CAPZA2  antibody</p>

<p>The GUF1 antibody is a highly specialized protein inhibitor that is used in Life Sciences research. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. The GUF1 antibody targets non-phosphorylated protein kinases, making it an essential tool for studying cellular signaling pathways. It can be used in a variety of applications, including Western blotting, immunoprecipitation, and immunohistochemistry. The GUF1 antibody is reactive against a wide range of proteins and has been shown to be effective in detecting autoantibodies associated with thrombocytopenia. With its high specificity and sensitivity, the GUF1 antibody is a valuable asset for any researcher working in the field of molecular biology or cell biology.</p>

<p>MED26 antibody was raised in Rabbit using Human MED26 as the immunogen</p>

<p>GCDH antibody was raised using the N terminal of GCDH corresponding to a region with amino acids SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA</p>

<p>The SLITRK6 antibody is a highly specialized monoclonal antibody that targets the activated form of SLITRK6, a protein involved in cell growth and development. This antibody-drug conjugate specifically binds to SLITRK6, inhibiting its function and preventing the activation of downstream signaling pathways. The SLITRK6 antibody has shown promising results in preclinical studies, demonstrating its potential as a targeted therapy for various types of cancer. Its unique mechanism of action makes it an attractive candidate for further research and development in the field of oncology. With its high specificity and potency, the SLITRK6 antibody holds great promise for improving patient outcomes and advancing the field of personalized medicine.</p>

<p>SAP30BP antibody was raised in rabbit using the C terminal of SAP30BP as the immunogen</p>

<p>Purified recombinant MMP3 protein (His tag)</p>

<p>The CDK5 antibody is a growth factor that plays a crucial role in various cellular processes. It has been shown to interact with ketanserin, a chemokine that regulates oxidative damage in cells. Monoclonal antibodies targeting CDK5 have been developed and are used in life sciences research to study its functions and mechanisms of action. CDK5 antibody has also been found to modulate dopamine signaling and regulate the expression of proteins such as e-cadherin and actin filaments. Additionally, it has been reported to have an impact on the production of erythropoietin and endothelial growth factors. By specifically binding to CDK5, this monoclonal antibody can help researchers gain insights into the intricate workings of cellular processes and potentially develop targeted therapies for various diseases related to CDK5 dysregulation.</p>

<p>CD29 antibody is a polyclonal antibody that specifically targets the CD29 protein. This protein, also known as integrin beta-1, plays a crucial role in cell adhesion and migration. The CD29 antibody can be used in various research applications, including immunohistochemistry, flow cytometry, and Western blotting.</p>