Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.116 produits)
- Par Biological Target(99.075 produits)
- Par usage/effets pharmacologiques(6.785 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.700 produits)
- Métabolites secondaires(14.220 produits)
130578 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Creatine Kinase protein (Bovine)
<p>Creatine kinase (also known as phosphocreatine kinase or creatine phosphokinase, CAS No [9001-15-4], EC 2.7.3.2) in an enzyme that catalyzes the following reaction:creatine + ATP ⇌ phosphocreatine + ADPOne unit of creatine kinase will transfer 1.0 μmole of phosphate from phosphocreatine to ADP per min at 37 °C.Bovine heart creatine kinase comes in lyophilized form as a red powder. It was lyophilized from tris chloride, EDTA and DTT. Its activity is ≥100U/mg, and specific activity is ≥200U/mg protein. Store at -20°C on arrival.</p>Degré de pureté :Min. 95%SQSTM1 antibody
<p>The SQSTM1 antibody is a cytotoxic agent used in Life Sciences research. It is commonly used to study the function of annexin A2, an important protein involved in various cellular processes. This antibody can be utilized in experiments such as immunofluorescence and Western blotting to detect the presence of SQSTM1 protein. Additionally, it has applications in clinical diagnostics for detecting autoantibodies against insulin and alpha-fetoprotein. The SQSTM1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. With its high specificity and sensitivity, this antibody is a valuable tool for studying various biological phenomena related to insulin regulation and cell signaling pathways.</p>APP antibody
<p>The APP antibody is a highly reactive monoclonal antibody used in Life Sciences. It is specifically designed to detect and bind to the amyloid precursor protein (APP), a glycoprotein involved in the growth factor signaling pathway. This antibody is commonly used in research and diagnostic applications to study the role of APP in various cellular processes.</p>B3galnt1 antibody
<p>B3galnt1 antibody was raised in rabbit using the C terminal of B3galnt1 as the immunogen</p>Degré de pureté :Min. 95%SNRP70 antibody
<p>SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids RERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDR</p>GFAP antibody
<p>The GFAP antibody is a neutralizing monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). GFAP is an intermediate filament protein found in astrocytes, a type of glial cell in the central nervous system. This antibody has been extensively studied in Life Sciences and has shown promising results in various applications.</p>SCAP antibody
<p>The SCAP antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that can be used for immobilization on electrodes, making it ideal for various research applications. This antibody specifically targets and binds to SCAP (Sterol Regulatory Element-Binding Protein Cleavage-Activating Protein), which plays a crucial role in cholesterol metabolism and lipid homeostasis. By targeting SCAP, researchers can gain valuable insights into the regulation of these processes.</p>Legionella pneumophila protein
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth.</p>Degré de pureté :Min. 95%CD11c antibody
<p>The CD11c antibody is a monoclonal antibody that specifically targets the CD11c protein. This protein is involved in various biological processes, including immune response and cell adhesion. The CD11c antibody has been extensively studied for its potential applications in the field of Life Sciences.</p>PODXL antibody
<p>The PODXL antibody is a highly specialized monoclonal antibody that targets the glycoprotein known as podocalyxin-like protein (PODXL). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>MYD88 antibody
<p>The MYD88 antibody is a growth factor that is commonly used in immunoassays. It plays a crucial role in various cellular processes, including the activation of mitogen-activated protein kinases and endonucleases. The MYD88 antibody specifically targets the p38 mitogen-activated protein kinase (MAPK) pathway, which is involved in immune responses and inflammation. By immobilizing and activating this pathway, the MYD88 antibody enhances the polymerase activity and caspase-9 activation, leading to increased cell proliferation and apoptosis. This antibody is available as both polyclonal antibodies and monoclonal antibodies, allowing for versatile applications in research and diagnostics. Additionally, the MYD88 antibody has been shown to interact with nuclear factor kappa-light-chain-enhancer (NF-κB), further contributing to its immunomodulatory properties.</p>CD45RO antibody
<p>The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.</p>LPL antibody
<p>The LPL antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of lipoprotein lipase (LPL), an enzyme involved in lipid metabolism. This antibody has been extensively studied for its potential therapeutic applications in various fields, including life sciences and ophthalmic formulations.</p>Lactoferrin antibody
<p>The Lactoferrin antibody is a drug antibody that specifically targets the target molecule, Lactoferrin. It is a disulfide bond-containing antibody that has been shown to have high affinity and specificity for Lactoferrin. This antibody can be used in various applications in Life Sciences, such as research, diagnostics, and therapeutics. It has been extensively studied and validated for its ability to detect Lactoferrin in human serum samples using techniques like electrode-based immunoassays. The Lactoferrin antibody can also be used in immunohistochemistry and flow cytometry experiments to study the expression of Lactoferrin in different tissues and cell types. Its versatility and reliability make it an essential tool for researchers working on understanding the role of Lactoferrin in various biological processes.</p>Goat anti Human κ chain (biotin)
<p>This antibody reacts with kappa light chains on human immunoglobulins.</p>Degré de pureté :Min. 95%KRT8 antibody
<p>The KRT8 antibody is a monoclonal antibody that specifically targets Keratin 8 (KRT8), a protein found in epithelial tissues. This antibody has been extensively studied and has shown promising results in various fields of research, particularly in the life sciences.</p>CTNNB1 antibody
<p>The CTNNB1 antibody is a highly potent monoclonal antibody that has shown promising results in the field of Life Sciences. It acts as an active agent by specifically targeting and binding to the CTNNB1 receptor, leading to cell lysis and inhibiting its signaling pathway. This antibody has been extensively studied for its ability to inhibit the growth of cancer cells and has shown potent antitumor activity in various preclinical models.</p>TYRO3 antibody
<p>TYRO3 antibody was raised in Mouse using a purified recombinant fragment of Tyro3 (aa138-321) expressed in E. coli as the immunogen.</p>ETNK2 antibody
<p>The ETNK2 antibody is a neuroprotective monoclonal antibody that has shown promising results in various studies. It has been found to promote the growth and survival of neurons and protect them from damage. This antibody specifically targets ETNK2, a protein involved in neuronal development and function.</p>PNPT1 antibody
<p>PNPT1 antibody was raised using the middle region of PNPT1 corresponding to a region with amino acids CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED</p>Oxytocin Receptor antibody
<p>Oxytocin receptor antibody was raised in rabbit using a 20 amino acid peptide of rat OTR as the immunogen.</p>Degré de pureté :Min. 95%Keratin K20 antibody
<p>Keratin K20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.</p>Goat anti Human IgG + IgA + IgM (rhodamine)
<p>This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.</p>Degré de pureté :Min. 95%RHEBL1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RHEBL1 antibody, catalog no. 70R-5824</p>Degré de pureté :Min. 95%ASCL1 antibody
<p>The ASCL1 antibody is a highly effective monoclonal antibody that targets and inhibits the activity of ASCL1, a transcription factor involved in the regulation of gene expression. This antibody has been extensively studied and proven to have significant therapeutic potential in various fields, including life sciences and medicine.</p>Neuropeptide Y antibody
<p>The Neuropeptide Y antibody is a growth factor that plays a crucial role in various physiological processes. This monoclonal antibody specifically targets neuropeptide Y, neutralizing its effects and preventing its interaction with receptors. It has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth and proliferation of cancer cells.</p>CBLB antibody
<p>CBLB antibody was raised in mouse using recombinant Human Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence B</p>BMPER antibody
<p>BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV</p>Degré de pureté :Min. 95%Deruxtecan
CAS :<p>an ADC drug-linker conjugate composed of an DX-8951 derivative (Exatecan) and a maleimide-GGFG peptide linker.</p>Formule :C52H56FN9O13Degré de pureté :Min. 95%Masse moléculaire :1,034.1 g/mol
