Produits biochimiques et réactifs

<p>The PLK1 antibody is a highly specialized monoclonal antibody that targets the polo-like kinase 1 (PLK1) protein. This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>Purified Polyclonal Carbonic Anhydrase 2 antibody</p>

<p>Mouse monoclonal PPM1F antibody</p>

<p>Mouse monoclonal AK4 antibody</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>The MHC Class II antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes MHC Class II molecules. These molecules play a crucial role in the immune response by presenting antigens to T cells, thereby initiating an immune response. The MHC Class II antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. It has been shown to effectively stain actin filaments, growth factors, collagen, glycoproteins, fibrinogen, and other cellular components. Additionally, this antibody has been used to study the role of MHC Class II molecules in various biological processes including antigen presentation and cytokine production. Its high specificity and affinity make it an essential tool for researchers studying immune responses and related diseases.</p>

<p>Rabbit polyclonal TFAP2C antibody</p>

<p>Purified Rabbit polyclonal GPRIN3 antibody</p>

<p>The CD1a antibody is a crucial tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets CD1a, a cell surface protein involved in various biological processes. This antibody can be used for research purposes to study the function and expression of CD1a in different cell types.</p>

<p>Sheep polyclonal Sulphatroxazole antibody</p>

<p>Purified recombinant LMX1B protein (His tag)</p>

<p>Rat monoclonal Rat anti-Mouse IgA antibody (FITC)</p>

<p>Mouse monoclonal NPR3 antibody</p>

<p>Rat monoclonal CIRE antibody (allophycocyanin)</p>

<p>Rabbit Polyclonal MRLC2 antibody (Ser18)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through patch-clamp technique experiments on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM</p>

<p>Purified Rabbit polyclonal Smad3 antibody (Ser213)</p>

<p>The HIV1 Nef protein is a vital component in the field of Life Sciences. It is a serine protease inhibitor that plays a crucial role in neutralizing the effects of HIV1. This Recombinant Protein &amp; Antigen forms dimers and has been extensively studied for its potential therapeutic applications. Researchers have found that it exhibits inhibitory effects on the replication of HIV1, making it a promising target for drug development.</p>

<p>Sheep polyclonal Flunixin COOH antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C20ORF100 antibody, catalog no. 70R-7817</p>

<p>Recombinant Human KLF4 protein (His tag)</p>

<p>CYP4B1 antibody was raised using the N terminal of CYP4B1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW</p>

<p>Armenian Hamster monoclonal CD69 antibody (PE)</p>

<p>LYVE1 antibody was raised in rabbit using recombinant human soluble Lyve-1 as the immunogen.</p>

<p>LDH antibody was raised in goat using full length lactate dehydrogenase protein isolated from rabbit muscle as the immunogen.</p>

<p>Rabbit polyclonal JAK2 antibody (Tyr931)</p>

<p>The STAT6 antibody is a protein-based antibody that specifically targets and binds to the STAT6 protein. This protein plays a crucial role in cellular signaling pathways and is involved in various biological processes such as immune response, cell growth, and differentiation. The STAT6 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>INTS12 antibody was raised in Rabbit using Human INTS12 as the immunogen</p>

<p>Mouse monoclonal ARHGAP25 antibody</p>

<p>S100 antibody was raised in mouse using human brain S-100 protein as the immunogen.</p>

<p>Tetracaine HCL (USP grade powder) chemical reference substance</p>

<p>Purified Polyclonal EGVEGF antibody</p>

<p>Purified recombinant FST protein (His tag)</p>

<p>ZBTB7C antibody was raised in rabbit using the N terminal of ZBTB7C as the immunogen</p>

<p>The MARCH5 antibody is a potent inhibitor that targets the MARCH5 protein. It belongs to the class of antibodies known as polyclonal antibodies, which are produced by multiple B cell clones and recognize different epitopes on the target antigen. The MARCH5 antibody specifically binds to a phosphorylation site on the MARCH5 protein, blocking its activity and preventing further phosphorylation events.</p>

<p>KEAP1 antibody was raised in rabbit using the C terminal of KEAP1 as the immunogen</p>

<p>C1orf57 antibody was raised in Rabbit using Human C1orf57 as the immunogen</p>

<p>Rabbit polyclonal p53 antibody (biotin)</p>

<p>ZDHHC24 antibody was raised using the N terminal of ZDHHC24 corresponding to a region with amino acids YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVML</p>

<p>The ZFP36 antibody is a powerful tool in the field of medicine. It is an autoantibody that specifically targets and binds to the ZFP36 protein, which plays a crucial role in nuclear regulation. This antibody can be used in various assays and experiments to study the function and localization of ZFP36.</p>

<p>Rabbit polyclonal CENTB1 antibody (Ser554)</p>

<p>PRMT3 antibody was raised in rabbit using the middle region of PRMT3 as the immunogen</p>

<p>Purified Rabbit polyclonal OR2J2 antibody</p>

<p>Mouse monoclonal TNNI3 antibody</p>

<p>HNRPH1 antibody was raised using the middle region of Hnrph1 corresponding to a region with amino acids FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0152 antibody, catalog no. 70R-8645</p>

<p>INTS3 antibody was raised in Rabbit using Human INTS3 as the immunogen</p>

<p>WDHD1 antibody was raised in rabbit using the C terminal of WDHD1 as the immunogen</p>