Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.129 produits)
- Par Biological Target(99.160 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.742 produits)
- Métabolites secondaires(14.222 produits)
130579 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
CMKLR1 antibody
<p>The CMKLR1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that can be used for various applications, including antiviral research and growth factor studies. This antibody specifically targets CMKLR1, a receptor involved in immune responses and inflammation.</p>TGIF2LY protein (His tag)
<p>Purified recombinant TGIF2LY protein (His tag)</p>Degré de pureté :Min. 95%rac-Enprostil
CAS :<p>rac-Enprostil is a synthetic prostaglandin analog derived from the natural compound prostaglandin E2, produced primarily via synthetic chemical processes. This compound functions by mimicking the action of endogenous prostaglandins on the gastrointestinal mucosa. It enhances the secretion of mucus and bicarbonate, promoting mucosal protection and stability. Additionally, rac-Enprostil inhibits gastric acid secretion, thus providing a protective effect against gastric lesions and ulcers.</p>Formule :C23H28O6Degré de pureté :Min. 95%Masse moléculaire :400.5 g/molN-(3S)-1-Azabicyclo[2.2.2]oct-3-yl-5,6-dihydro-1-naphthalenecarboxamide
CAS :<p>N-(3S)-1-Azabicyclo[2.2.2]oct-3-yl-5,6-dihydro-1-naphthalenecarboxamide is a research tool that can be used as an activator or ligand to study protein interactions in cell biology and pharmacology. It has been reported to inhibit the activity of ion channels, such as voltage gated potassium channels and calcium channels. N-(3S)-1-Azabicyclo[2.2.2]oct-3-yl-5,6-dihydro-1-naphthalenecarboxamide also blocks the binding of antibodies to cells and peptides in vitro, which may be due to its ability to inhibit protein synthesis. This chemical is listed on CAS Registry Number 1227162-75-5 and has a purity of >99%.</p>Formule :C18H22N2ODegré de pureté :Min. 95%Masse moléculaire :282.4 g/molTNFRSF9 protein
<p>TNFRSF9 protein is a growth factor that plays a crucial role in various biological processes. It can be targeted using monoclonal antibodies to treat conditions such as cancer and autoimmune diseases. TNFRSF9 protein acts as a chemokine and has anti-VEGF (vascular endothelial growth factor) properties, making it an effective antiangiogenic agent. It also has neutralizing effects on TNF-α (tumor necrosis factor-alpha), which is involved in inflammation and immune responses. TNFRSF9 protein is widely used in the field of life sciences for research purposes, including the development of conjugated proteins and monoclonal antibodies like adalimumab and interferon. Its interaction with other molecules, such as oncostatin, further expands its potential therapeutic applications.</p>Degré de pureté :Min. 95%1-((4-(3-Fluorophenyl)-1-(2-methoxy-4-nitrophenyl)sulfonylpyrrolidin-3-yl)methyl)-4-pyridin-2-ylpiperazine
CAS :<p>1-((4-(3-Fluorophenyl)-1-(2-methoxy-4-nitrophenyl)sulfonylpyrrolidin-3-yl)methyl)-4-pyridin-2-ylpiperazine is a drug that belongs to the group of angiotensin receptor antagonists. It was developed for the treatment of pulmonary hypertension and cardiac hypertrophy. 1-(4-(3-Fluorophenyl)-1-(2-methoxy-4-nitrophenyl)sulfonylpyrrolidin-3-yl)methyl)-4 pyridin 2 yl piperazine inhibits the binding of angiotensin II to its receptors in the heart and blood vessels, thereby preventing vasoconstriction and reducing blood pressure. This drug also has been shown to inhibit collagen synthesis in human endometrial cells and lung fibroblasts by blocking transcriptional regulation of type I</p>Formule :C27H30FN5O5SDegré de pureté :Min. 95%Masse moléculaire :555.6 g/molMK-8033 hydrochloride
CAS :<p>MK-8033 hydrochloride is a peptide that is used as a research tool for cell biology and pharmacology studies. It is an inhibitor of voltage-gated potassium channels, which are important for the transmission of nerve impulses. This drug has a high purity, and it has shown to be an activator of certain ion channels. MK-8033 hydrochloride binds to the N-terminal region of the alpha subunit of the acetylcholine receptor, which may increase its affinity for acetylcholine. MK-8033 hydrochloride has also been shown to inhibit ligand binding to receptors in cells, leading to inhibition of protein synthesis.</p>Formule :C25H22ClN5O3SDegré de pureté :Min. 95%Masse moléculaire :507.99 g/molPhenoxathiine 10,10-dioxide
CAS :<p>Phenoxathiine 10,10-dioxide is a diphenyl ether that has been shown to have suzuki coupling activity. It can be used as an intermediate for the synthesis of polymers. Phenoxathiine 10,10-dioxide is soluble in acidic solutions and insoluble in neutral solutions. Structural analysis has revealed that phenoxathiine 10,10-dioxide contains a carbonyl group and a hydroxyl group, which are responsible for the solubility difference. The reaction mechanism of phenoxathiine 10,10-dioxide has been studied using human liver microsomes and found that it proceeds through a nucleophilic substitution at the chlorine atom. NMR spectra indicate that phenoxathiine 10,10-doxide contains an intramolecular hydrogen bond between the carbonyl group and the hydroxyl group.</p>Formule :C12H8O3SDegré de pureté :Min. 95%Masse moléculaire :232.26 g/molLY223982
CAS :<p>LY223982 is a covalent linkage-forming compound that inhibits the activity of serine proteases. It has been shown to inhibit the protease activity of cytosolic calcium-dependent, chemotactic factors and other compounds in experimental models of infectious diseases such as tuberculosis and AIDS. LY223982 binds to and inhibits the catalytic site of serine proteases such as trypsin, chymotrypsin, elastase, cathepsin G, proteinase 3 and urokinase-type plasminogen activator. This drug is also an inhibitor of activated adhesion molecules that are involved in inflammatory processes.</p>Formule :C30H30O7Degré de pureté :Min. 95%Masse moléculaire :502.56 g/molGFP antibody
<p>GFP antibody was raised in rabbit using E. Coli-expressed full length green fluorescent protein as the immunogen.</p>2-Deces
CAS :<p>2-Deces is a peptide that has been used as a research tool to study the interactions of ion channels and receptors. It is an inhibitor of the L-type calcium channel and it is able to block protein interactions by binding to the receptor. 2-Deces has been shown to inhibit the activity of nicotinic acetylcholine receptors, which are found in both muscles and neurons. The inhibition of these receptors leads to a decrease in muscle contractions, making 2-Deces an effective treatment for muscle spasms.<br>2-Deces has also been shown to inhibit potassium channels, which can lead to decreased neuronal excitability.</p>Formule :C20H37NOSDegré de pureté :Min. 95%Masse moléculaire :339.6 g/molGSTM1 antibody
<p>GSTM1 antibody was raised in rabbit using the C terminal of GSTM1 as the immunogen</p>Degré de pureté :Min. 95%Septin 12 antibody
<p>Septin 12 antibody was raised using the middle region of 40433 corresponding to a region with amino acids LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD</p>Degré de pureté :Min. 95%CANT1 antibody
<p>CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY</p>Degré de pureté :Min. 95%Chemerin-9
CAS :<p>Chemerin-9 is a peptide that can be used in research as a tool for cell biology, pharmacology, and life science. It has been shown to inhibit the receptor of chemerin-1, which is involved in immune system regulation. Chemerin-9 also interacts with the ligand of chemerin-1, which may be an important factor in the development of medications for treatment of autoimmune diseases.</p>Formule :C54H66N10O13Degré de pureté :Min. 95%Masse moléculaire :1,063.18 g/molVapreotide acetate
CAS :Produit contrôlé<p>Vapreotide acetate is a synthetic somatostatin analog, which is derived through chemical synthesis to mimic the naturally occurring hormone somatostatin. Its mode of action involves binding to somatostatin receptors, leading to the inhibition of the secretion of several hormones and growth factors, such as growth hormone (GH), insulin, glucagon, and gastrin. This inhibitory effect is achieved due to its structural similarity to somatostatin, allowing it to effectively modulate endocrine and exocrine functions.</p>Formule :C59H74N12O11S2Degré de pureté :Min. 95%Masse moléculaire :1,191.4 g/molM2698
CAS :<p>M2698 is a monoclonal antibody that binds to the epithelial growth factor receptor (EGFR) and inhibits tumor cell growth. M2698 has been shown to inhibit tumor cell proliferation in vitro and in vivo, as well as decrease tumor size in mice. The drug also has therapeutic potential for breast cancer patients who have HER2+ tumors. M2698 is currently undergoing Phase I clinical trials for the treatment of breast cancer with high levels of HER2 protein expression.</p>Formule :C21H19ClF3N5ODegré de pureté :Min. 95%Masse moléculaire :449.9 g/molInvolucrin antibody
<p>The Involucrin antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to the messenger RNA (mRNA) of involucrin, a protein that plays a crucial role in the formation of the epidermal barrier. This antibody is highly effective in detecting and quantifying involucrin levels in various samples, including human liver microsomes and rat liver microsomes.</p>Paroxetine maleate
CAS :Produit contrôlé<p>A serotonin reuptake inhibitor with anticholinergic activity and mild inhibitory activity on noradrenaline reuptake. Paroxetine has been used for the treatment of depression, anxiety disorders, post-traumatic stress disorder, premenstrual dysphoric disorder and obsessive-compulsive disorder. Also inhibits nitric oxide synthase and cytochrome isoenzyme P450 2D6.</p>Formule :C19H20NO3F•C4H4O4Degré de pureté :Min. 95%Masse moléculaire :445.44 g/molSelonsertib hydrochloride
CAS :<p>Selonsertib hydrochloride is a potent ASK1 (Apoptosis signal-regulating kinase 1) inhibitor, which is a targeted small molecule therapeutic derived from chemical synthesis. Its mode of action involves the inhibition of ASK1, a kinase enzyme involved in cellular apoptosis and inflammation pathways. Specifically, ASK1 is upstream in the MAPK signaling cascade that modulates oxidative stress responses, often implicated in various pathological states.</p>Formule :C24H25ClFN7ODegré de pureté :Min. 95%Masse moléculaire :482 g/mol2-((4-Chlorophenyl)thio)-N-(4-(pyridin-2-yl)thiazol-2-yl)acetamide
CAS :<p>2-((4-Chlorophenyl)thio)-N-(4-(pyridin-2-yl)thiazol-2-yl)acetamide is a ligand that binds to potassium channels. It inhibits the opening of these channels, which blocks the propagation of nerve impulses and prevents muscle contraction. The maximum inhibition is achieved at 0.1 μM, and it has been shown to be selective for potassium channels over sodium channels. This agent can also be used as an immunogen to generate antibodies against potassium ion channels.</p>Formule :C16H12ClN3OS2Degré de pureté :Min. 95%Masse moléculaire :361.9 g/mol2-Nitrobenzaldehyde semicarbazone 13C,15N2
CAS :<p>2-Nitrobenzaldehyde semicarbazone 13C,15N2 is a potent inhibitor of kinases that play a crucial role in the growth and survival of cancer cells. It has been shown to induce apoptosis in human cancer cell lines by inhibiting the cell cycle and promoting anticancer activity. This medicinal analog has been tested on Chinese hamster ovary (CHO) cells, where it was found to inhibit protein synthesis and promote tumor cell death. Additionally, this compound has been used as a urine biomarker for the diagnosis of cancer due to its ability to detect specific proteins associated with cancer cells. Overall, 2-Nitrobenzaldehyde semicarbazone 13C,15N2 shows great promise as an effective anticancer agent with potential applications in both research and clinical settings.</p>Formule :C8H8N4O3Degré de pureté :Min. 95%Masse moléculaire :211.15 g/molUridine- 13C9, 15N2
CAS :<p>Please enquire for more information about Uridine- 13C9, 15N2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C9H12N2O6Degré de pureté :Min. 95%Masse moléculaire :255.12 g/molDonkey anti Goat IgG (H + L) (biotin)
<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>Degré de pureté :Min. 95%Benazeprilat-d5
CAS :<p>Benazeprilat-d5 is an inhibitor that can be used in the treatment of cancer. It has been shown to induce apoptosis in cancer cells and has anticancer properties. This drug is a kinase analog inhibitor that targets specific proteins involved in tumor growth and proliferation. Studies have shown that Benazeprilat-d5 inhibits Chinese hamster ovary cell proliferation and reduces the activity of various kinases involved in cancer cell growth. It is excreted primarily through urine in humans, making it a safe and effective treatment option for those suffering from cancer. Additionally, Benazeprilat-d5 has been found to enhance the effects of other anticancer drugs such as octreotide, making it a promising new therapy for cancer patients.</p>Formule :C22H24N2O5Degré de pureté :Min. 95%Masse moléculaire :401.5 g/molRLN2
<p>RLN2 is an oncogene that encodes a protein with a sequence of amino acids similar to the anti-cancer drug docetaxel. It is expressed in resistant prostate cancer cells and has been shown to modulate cytogenetics, haematology, and tissue microarrays. The RLN2 gene is also expressed in ligaments and may be associated with chemoresistance.</p>Degré de pureté :Min. 95%IL6 antibody
<p>IL6 antibody was raised in rabbit using highly pure recombinant hIL-6 as the immunogen.</p>SQSTM1 antibody
<p>The SQSTM1 antibody is a monoclonal antibody that is highly effective in neutralizing the protein SQSTM1. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to inhibit the activation of SQSTM1, which plays a crucial role in several cellular processes. The SQSTM1 antibody can be used for research purposes, such as studying the effects of SQSTM1 on cell growth and differentiation. Additionally, it has shown potential therapeutic benefits in targeting specific diseases associated with abnormal SQSTM1 activity, including certain types of cancer and neurodegenerative disorders. With its high specificity and low density, this monoclonal antibody offers great potential in biomaterials and drug development.</p>Jh-xi-10-02
CAS :<p>Jh-xi-10-02 is a heterobifunctional molecule that inhibits ubiquitin ligases and targets cancer cells. It is an inhibitor of the ubiquitin-proteasome pathway, which is a cellular pathway that degrades and recycles proteins. Jh-xi-10-02 prevents the degradation of cortistatin, leading to increased levels of this protein in mammalian cells. This drug also has pharmacokinetic properties and can be synthesized without toxicities. Jh-xi-10-02 has been shown to inhibit the growth of cancer cells in culture and in animal models, suggesting it may be a potential anticancer agent.</p>Formule :C53H69N5O9Degré de pureté :Min. 95%Masse moléculaire :920.14 g/molL-Phenylalanyl-D-valyl-L-valyl-D-phenylalaninamide
CAS :<p>L-Phenylalanyl-D-valyl-L-valyl-D-phenylalaninamide is a peptide that acts as an activator of ion channels. LPAVVDA is a synthetic peptide that contains four amino acids and has the sequence L-Phenylalanyl-D-valyl--L--Valyl--D--phenylalaninamide. It was developed to be used as a research tool, but it also has potential uses in antibody production and cell biology. This peptide can be used to study protein interactions, receptor binding, and ligand binding. It also has pharmacological applications for use as an inhibitor of ion channels or for use in protein purification.</p>Formule :C28H39N5O4Degré de pureté :Min. 95%Masse moléculaire :509.6 g/molSRR antibody
<p>The SRR antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It has been extensively used in research studies to investigate the role of ketanserin, an antagonist of serotonin receptors, as well as other growth factors and angiogenic factors. The SRR antibody has been widely employed in agglutination assays to study the interaction between different molecules such as superoxide, dopamine, fibrinogen, collagen, and erythropoietin. Additionally, it has been utilized in experiments involving phalloidin staining and endothelial growth assays. With its high specificity and reliability, the SRR antibody is an invaluable tool for scientists working in diverse areas of biological research.</p>AZD5423
CAS :<p>AZD5423 is a fatty acid that has inhibitory properties on the cells in the colon. It has been shown to have clinical relevance for the treatment of autoimmune diseases, such as Crohn's disease and ulcerative colitis. AZD5423 also inhibits transrepression in caco-2 cells and reduces the inflammatory response in vivo. The molecule is synthesized by an asymmetric synthesis process with a diameter of 3.7 nm and potent inhibition against particle size of 2.5 nm. Clinical studies are underway to determine the efficacy of this drug in treating inflammatory diseases, including psoriasis and rheumatoid arthritis.</p>Formule :C25H21F4N3O3Degré de pureté :Min. 95%Masse moléculaire :487.45 g/molRBM34 antibody
<p>RBM34 antibody was raised using the C terminal of RBM34 corresponding to a region with amino acids SKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQK</p>Setipiprant(ACT-129968)
CAS :<p>Setipiprant is a CRTH2-selective antagonist, which has been shown to be effective in reducing the incidence of asthma exacerbations and bronchoconstriction. It also has a good safety profile with no significant adverse effects observed in clinical studies. Setipiprant binds to the CRTH2 receptor and blocks its activation by prostaglandin D2 (PGD2) or leukotriene B4 (LTB4). This inhibition prevents the release of inflammatory mediators from mast cells, which are responsible for airway inflammation in asthma. Setipiprant is being developed as a potential treatment for chronic asthma, allergic rhinitis, and chronic obstructive pulmonary disease (COPD). The molecule has been shown to bind to the CRTH2 receptor with an affinity that is about 10 times higher than that of cetirizine, another anti-inflammatory drug. This binding profile makes setipiprant an ideal candidate for treatment of inflammatory diseases</p>Formule :C24H19FN2O3Degré de pureté :Min. 95%Masse moléculaire :402.42 g/molGYKI 53655 hydrochloride
CAS :<p>AMPA receptor antagonist</p>Formule :C19H21N4O3ClDegré de pureté :Min. 95%Masse moléculaire :388.85 g/molCSPG5 antibody
<p>The CSPG5 antibody is a highly specialized monoclonal antibody that targets collagen, a key component of human serum and various biomolecules. This antibody is widely used in the field of Life Sciences for research purposes. It can be employed in various applications such as immobilization on electrodes, detection of glutamate levels, and analysis of pleural fluid. Additionally, the CSPG5 antibody has demonstrated cytotoxic and inhibitory effects on growth factors, making it a valuable tool for studying cellular processes and signaling pathways. With its high specificity and versatility, this antibody is an essential resource for scientists and researchers in the field.</p>GW441756
CAS :<p>GW441756 is a specific agonist of the epidermal growth factor receptor that has been shown to inhibit bladder cancer and skin cancer. It can also reduce the severity of inflammatory bowel disease, infectious diseases, and skin cancer. GW441756 has been found to have antiinflammatory activity by inhibiting prostaglandin synthesis in the lung. This drug blocks signal pathways in cells by binding to specific receptors for growth factors such as epidermal growth factor (EGF) and neurotrophic factors. GW441756 binds to EGF receptors on the surface of cells in order to inhibit cell proliferation, which prevents cell cycle progression from G1 phase to S phase.<br>GW441756 also induces apoptosis by binding with EGF receptors on the surface of cells and activating a signaling pathway that leads to activation of caspases, which are enzymes that cleave proteins into smaller fragments that are eventually degraded or eliminated from the cell.</p>Formule :C17H13N3ODegré de pureté :Min. 95%Masse moléculaire :275.3 g/molCHRM3 antibody
<p>CHRM3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%1-EBIO
CAS :<p>1-EBIO is a pharmacological agent that inhibits the mitochondrial membrane potential. It has been shown to have low potency against infectious diseases, but high potency against pluripotent cells. 1-EBIO is an apical cation channel blocker that has been shown to inhibit the activity of whole-cell recordings in cells infected with HIV and other pathogens. It is also a potent inhibitor of cellular physiology, which may be due to its ability to inhibit the production of cytokine IL-2 receptor, a protein necessary for cell proliferation. 1-EBIO blocks cytosolic Ca2+ levels in hl-60 cells by inhibiting mitochondrial membrane potential through binding to dinucleotide phosphate (DNP).</p>Formule :C9H10N2ODegré de pureté :Min. 95%Masse moléculaire :162.19 g/molBay 11-7085
CAS :<p>Bay 11-7085 is a synthetic chemical inhibitor that is utilized in scientific research. It is derived from a class of bioactive molecules designed to interfere with specific cellular pathways. Bay 11-7085 functions as a covalent inhibitor of the NF-κB signaling pathway, a critical regulator of immune response and cell survival. By targeting the phosphorylation of IκBα, Bay 11-7085 effectively prevents the translocation of NF-κB to the nucleus, thereby modulating gene expression and inhibiting downstream effects.</p>Formule :C13H15NO2SDegré de pureté :Min. 95%Masse moléculaire :249.33 g/mol
