Produits biochimiques et réactifs

<p>Please enquire for more information about TSH protein &gt;98% including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The CD106 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to bind to the CD106 antigen, a cell surface protein involved in various immune responses and inflammation processes. This mouse monoclonal antibody has been extensively tested and validated for its high affinity and specificity in peptide binding assays.</p>

<p>Please enquire for more information about Human IgA antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ICI 174864 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MSI1 antibody was raised in rabbit using residues 5-21 [APQPGLASPDSPHDPCK] of the human mushashi protein as the immunogen.</p>

<p>Please enquire for more information about Des-[4,5-o-(1-methylethylidene)] topiramate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Myr-Ser-Ile-Tyr-Arg-Arg-Gly-Ala-Arg-Arg-Trp-Arg-Lys-Leu is a peptide that has been shown to activate potassium channels in the central nervous system. It has been suggested as a potential treatment for epilepsy and Parkinson's disease. Myr Ser Ile Tyr Arg Arg Gly Ala Arg Arg Trp Arg Lys Leu is also an inhibitor of ligand binding to the GABA receptor, which may be useful in the treatment of anxiety disorders.</p>

<p>Ethyl 4-(benzyloxy)-7-bromo-2-naphthoate is a synthetic benzyloxy naphthalene derivative. It has been used in research as a peptide inhibitor with specificity for the receptor tyrosine kinase. Ethyl 4-(benzyloxy)-7-bromo-2-naphthoate can also be used as a ligand to study protein interactions and antibody binding, as well as cell biology, pharmacology, and life science. This product has high purity and can be used as an activator or inhibitor in ion channels or receptors.</p>

<p>Ala-Arg-Gly-Ile-Lys-Gly-Ile-Arg-Gly-Phe-Ser-Gly• 3AcOH• 5H2O is a peptide that is the substrate for lysine hydroxylase. Lysine hydroxylase catalyzes the conversion of lysine to 2,3 diaminopropionic acid (DAPA) and hydrogen peroxide. The reaction proceeds in two steps: first, the enzyme converts L -lysine to L -3,4 diaminobutyric acid (DABA), then it reacts with oxygen to form DAPA.</p>

<p>ITGAX antibody was raised in Rabbit using Human ITGAX as the immunogen</p>

<p>GDC-0326 is a drug that belongs to the class of lipid kinase inhibitors. It has been shown to be effective against infectious diseases, including those caused by bacteria and viruses. GDC-0326 has been shown to inhibit protein synthesis by binding to a specific site on an enzyme called protein kinase C (PKC), which is involved in the immune response. GDC-0326 binds to PKC at the same site as other drugs, such as PDBu or rolipram, but with different affinity. This drug also inhibits endothelial cell proliferation and has been shown to be effective against cancer cells in vitro. GDC-0326 is also able to bind to both erythrocytes and lymphocytes, making it useful for diagnostic purposes. It can also bind with high affinity to receptors on various types of cells, including tumor cells.br&gt;<br>GDC-0326 can exist in two tautomers: a keto form and an enol</p>

<p>Valdivione is a medicinal compound with potent anticancer properties. It acts as an inhibitor of protein kinases, which are enzymes that regulate cellular signaling pathways involved in cell growth and division. Valdivione has been shown to induce apoptosis, or programmed cell death, in tumor and cancer cells. This compound is an analog of a natural product isolated from a Chinese plant and has demonstrated significant activity against various types of cancer. Valdivione has been found to be effective against multiple kinases, including those involved in the growth and proliferation of cancer cells. This compound is excreted primarily in urine and shows promise as a potential cancer therapy.</p>

<p>Rat monoclonal Pax5 antibody (PE)</p>

<p>Mouse monoclonal GSTT2 antibody</p>

<p>ACAT1 antibody was raised using the middle region of ACAT1 corresponding to a region with amino acids GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH</p>

<p>WNT10B antibody was raised using the middle region of WNT10B corresponding to a region with amino acids GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR</p>

<p>M-CSF antibody was raised in goat using highly pure recombinant murine M-CSF as the immunogen.</p>

<p>Oxycodone N Conjugate for use in immunoassays</p>

<p>Please enquire for more information about 1,2-Dimyristoyl-d54-sn-glycero-3-phosphocholine-1,1,2,2-d4-N,N,N-trimethyl-d9 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Phosphatidylinositol tris-3,4,5-phosphate, 1,2-dipalmitoyl sodium including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse monoclonal SSR1 antibody</p>

<p>3-Butyryl-4-(2-methylphenylamino)-8-methoxyquinoline is an inhibitor of voltage-dependent calcium channels. It has been shown to inhibit the activity of p-hydroxybenzoic acid, which is a cell factor that regulates calcium levels in cells. 3-Butyryl-4-(2-methylphenylamino)-8-methoxyquinoline has been used in clinical pathology as an energy metabolism regulator and for the treatment of congestive heart failure by inhibiting voltage dependent calcium channels. This drug has also shown a protective effect on cancer tissues and some physiological effects, such as a reduction in hippocampal formation and pathogenic mechanism. The drug decreases mitochondrial membrane potential by interfering with the function of voltage dependent calcium channels, reducing ATP production and causing cell death.</p>

<p>CYP2C11 antibody was raised in rabbit using Synthetic peptides corresponding to residues D(49) I G Q S I K K F S K V(60) and Q(491) R A D S L S S H L(500) of rat Cytochrome P450 2C11 as the immunogen.</p>

<p>The FABP antibody is a powerful tool for research in the field of retinoid and chemokine biology. This antibody specifically targets and binds to fatty acid-binding proteins (FABPs), which are involved in the transport and metabolism of fatty acids. The antigen-antibody reaction between the FABP antibody and its target enables researchers to study the expression, localization, and function of FABPs in various biological samples.</p>

<p>Mouse monoclonal NK1.1 antibody (biotin)</p>

<p>Goat Serum antibody is a high-quality recombinant antigen that is used in various Life Sciences applications. It is produced from goat serum and contains reactive antibodies that can be used in immunoassays and other research experiments. The serum also contains alanine, which plays an important role in protein synthesis and metabolism. Additionally, it has been found to react with ascorbic acid, colloidal particles, and reactive oxygen species. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs. It can be used in a variety of assays, including polymerase chain reaction (PCR) and particle chemiluminescence assays. Furthermore, this antibody has neutralizing properties, making it suitable for blocking specific interactions or pathways of interest. With its diverse applications and high-quality composition, Goat Serum antibody is an essential tool for any researcher in the field of Life Sciences.</p>

<p>Complement Factor B is a growth factor that plays a crucial role in thrombotic microangiopathy. It is activated by autoantibodies and is involved in various biological processes. Complement Factor B acts as a protease and cleaves the C3b component of the complement system, leading to the formation of C3 convertase and subsequent activation of the complement cascade. This protein is essential for the clearance of immune complexes and pathogens, as well as for the regulation of inflammation. Complement Factor B can be used in Life Sciences research, particularly in studies related to immune response and complement-mediated diseases. It is available as a lyophilized product, ensuring stability and ease of use. With its high purity and native structure, Complement Factor B is an ideal choice for experiments requiring biologically active agents.</p>

<p>Rabbit polyclonal MRPS17 antibody</p>

<p>The Plasminogen antibody is a growth factor that plays a crucial role in various biological processes. It contains acid residues that enable it to bind to fibrinogen and exert its proteolytic activity. This Polyclonal Antibody can specifically recognize and bind to the Plasminogen antigen, leading to the formation of antigen-antibody complexes. These complexes have been shown to have various biological effects, including the regulation of hepatocyte growth and the modulation of microvessel density.</p>

<p>RSV antibody was raised in rabbit using residues 180-198 TCWAICKRIPNKKPGKK of the human RSV G protein A2 strain as the immunogen.</p>

<p>Purified recombinant FGF17 protein (His tag)</p>

<p>The FAM84B antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets FAM84B, an important protein involved in various biological processes. This antibody has been extensively studied and validated for its efficacy and specificity.</p>

<p>Region of IL31 protein corresponding to amino acids MTCSLSFGAP ISKEDLRTTI DLLKQESQDL YNNYSIKQAS GMSADESIQL PCFSLDREAL TNISVIIAHL EKVKVLSENT VDTSWVIRWL TNISCFNPLN LNISVPGNTD ESYDCKVFVL TVLKQFSNCM AELQAKDNTT C.</p>

<p>Sesn1 antibody was raised in rabbit using the C terminal of Sesn1 as the immunogen</p>

<p>The ATF2 antibody is a high-quality polyclonal antibody that specifically targets and neutralizes the activity of ATF2, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and efficacy. It binds to ATF2 with high affinity, inhibiting its function and preventing its interaction with other proteins.</p>

<p>Rabbit polyclonal TICAM2 antibody</p>

<p>Rabbit polyclonal TEKT2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C21orf56 antibody, catalog no. 70R-1971</p>

<p>TRIT1 antibody was raised in rabbit using the middle region of TRIT1 as the immunogen</p>

<p>Rabbit polyclonal PDK1 antibody (Tyr9)</p>

<p>The Lck antibody is a powerful cytotoxic agent that targets TGF-β1, a protein involved in cell growth and differentiation. It is a polyclonal antibody that can be used in various life science applications. The Lck antibody has been shown to inhibit the activity of GM-CSF (colony-stimulating factor) and other growth factors, making it an effective tool for studying cell signaling pathways. Additionally, this antibody can be used as a monoclonal antibody to specifically target and neutralize Lck, a tyrosine kinase involved in T-cell activation. Its specificity towards Lck makes it an invaluable tool for researchers studying immune responses and related diseases.</p>

<p>The ACAT1 antibody is a colloidal antibody that is used in various life science applications. It specifically targets and binds to the ACAT1 protein, which is involved in cholesterol metabolism and lipid storage. This antibody can be used for research purposes, such as studying the role of ACAT1 in cellular processes or as a diagnostic tool for detecting the presence of ACAT1 in biological samples. The ACAT1 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs. It has been validated for use in various assays, including immunofluorescence (IF), immunohistochemistry (IHC), western blotting (WB), and enzyme-linked immunosorbent assay (ELISA). With its high specificity and sensitivity, the ACAT1 antibody is a valuable tool for investigating the function and regulation of ACAT1 in different biological systems.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DND1 antibody, catalog no. 70R-4729</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL</p>

<p>Purified recombinant EPGN protein (His tag)</p>

<p>HMOX1 antibody was raised in Rabbit using Human HMOX1 as the immunogen</p>

<p>Plasmodium vivax antibody is a Monoclonal Antibody that specifically targets the adeno-associated virus (AAV) oncogene homolog in Plasmodium vivax. It has been developed for use in bioassays and research in the Life Sciences field. This antibody binds to the target molecule, inhibiting its activity and preventing the growth and replication of Plasmodium vivax. The antibody complex formed by Plasmodium vivax antibody has shown efficacy in inhibiting caspase-9, an enzyme involved in apoptosis, and reducing steroid levels in human serum. Additionally, this antibody has potential applications in targeting other parasitic organisms such as Cryptosporidium. With its high specificity and potent inhibitory effects, Plasmodium vivax antibody is a valuable tool for researchers studying parasitic infections and developing new therapeutic strategies.</p>

<p>PTPRR antibody was raised using the N terminal of PTPRR corresponding to a region with amino acids NIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIP</p>

<p>HBcAg antibody was raised in mouse using recombinant HBcAg as the immunogen.</p>