Produits biochimiques et réactifs

<p>Mouse monoclonal KIAA0495 antibody</p>

<p>NUDT21 antibody was raised in mouse using recombinant Human Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (Nudt21)</p>

<p>Mouse monoclonal CD235a antibody (biotin)</p>

<p>OVA conjugated Cholic acid Hapten</p>

<p>Rabbit polyclonal OR9G4 antibody</p>

<p>The RPN2 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used in research and diagnostic applications to study insulin and its related functions. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most appropriate option for their specific needs.</p>

<p>Fgf3 antibody was raised in rabbit using the C terminal of Fgf3 as the immunogen</p>

<p>EIF4H antibody was raised using the C terminal of EIF4H corresponding to a region with amino acids TEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE</p>

<p>Rabbit polyclonal RPL10A antibody</p>

<p>Rabbit polyclonal LATS antibody (Thr1079/1041)</p>

<p>INTS4 antibody was raised in Rabbit using Human INTS4 as the immunogen</p>

<p>RP11-78J21.1 antibody was raised using the N terminal of RP11-78J21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN</p>

<p>GNL2 antibody was raised in Rabbit using Human GNL2 as the immunogen</p>

<p>CCNB1 antibody was raised in Mouse using a purified recombinant fragment of human CCNB1 expressed in E. coli as the immunogen.</p>

<p>Purified Rabbit polyclonal OR5M9 antibody</p>

<p>ZBTB9 antibody was raised in rabbit using the C terminal of ZBTB9 as the immunogen</p>

<p>C5ORF24 antibody was raised using the middle region of C5Orf24 corresponding to a region with amino acids SIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKT</p>

<p>Purified Polyclonal IKK beta antibody</p>

<p>CD33 Monoclonal Antibody (RPE)</p>

<p>Rabbit polyclonal ST7L antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Purified Rabbit polyclonal ZNF394 antibody</p>

<p>Mouse monoclonal CBWD1 antibody</p>

<p>TAAR5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>HAS1 antibody was raised in Mouse using a purified recombinant fragment of human HAS1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal POLR1B antibody</p>

<p>Purified Polyclonal VWA5A antibody</p>

<p>The SLUG antibody is a monoclonal antibody that specifically targets a molecule called SLUG. It has cytotoxic properties, meaning it can kill cells that express SLUG. This antibody has been extensively studied and shown to be effective in various applications.</p>

<p>MYL1 antibody was raised in Rabbit using Human MYL1 as the immunogen</p>

<p>Integrin Beta 8 antibody was raised using the C terminal of ITGB8 corresponding to a region with amino acids CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL</p>

<p>LCORL antibody was raised in Rabbit using Human LCORL as the immunogen</p>

<p>Neuromedin U antibody was raised in rabbit using synthetic neuromedin U-8, porcine sequence, conjugated to BSA as the immunogen.</p>

<p>Mouse monoclonal 200 kDa Neurofilament antibody</p>

<p>Purified Polyclonal Cytochrome P450 2C9 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Its effectiveness has been demonstrated through advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. This drug undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets Mycobacterium tuberculosis strains and inhibits their growth in culture. Tilmicosin is a macrolide antibiotic widely used in veterinary medicine for the treatment of respiratory disorders in animals. By binding to the 50S ribosomal subunit, it effectively inhibits bacterial growth. Tilmicosin's efficacy extends to combating Clostridium perfr</p>

<p>Purified recombinant HINT2 protein (His tag)</p>

<p>Purified recombinant ZMAT3 protein (His tag)</p>

<p>Mouse monoclonal EPM2AIP1 antibody</p>

<p>Mouse monoclonal RFXANK antibody</p>

<p>GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE</p>

<p>The CD137L antibody is a powerful tool in the field of life sciences. It has the ability to induce lysis, or cell death, in certain cells. This antibody specifically targets parathyroid hormone-related protein (PTHrP), fibronectin, insulin, E-cadherin, and β-catenin. It is a polyclonal antibody, which means it is derived from multiple sources and can recognize various epitopes on its target proteins.</p>

<p>TNF alpha protein is a neutralizing antibody that targets glial fibrillary acidic proteins in the human body. It is widely used in Life Sciences research and can be conjugated to cellulose for various applications. This monoclonal antibody specifically binds to TNF-α, a cytokine involved in inflammation and immune response. By binding to TNF-α, this antibody inhibits its activity and reduces the inflammatory response. TNF alpha protein has been shown to effectively neutralize TNF-α in human serum, making it a valuable tool for studying the role of this cytokine in various diseases and conditions. Additionally, it has been found to have inhibitory effects on adipose tissue, suggesting potential therapeutic applications in obesity-related disorders. With its high specificity and efficacy, TNF alpha protein is an essential component in research related to inflammatory diseases and immune regulation.</p>

<p>The Myoglobin antibody is a highly specific monoclonal antibody that targets the myoglobin protein. It can be used in various applications, such as immunoassays, protein-protein interaction studies, and as an inhibitor in life science research. This antibody is produced using isolated nucleic acids and has been extensively tested for its specificity and sensitivity. It binds to myoglobin with high affinity, making it an ideal tool for detecting and quantifying myoglobin levels in biological samples. The Myoglobin antibody is conjugated with maleimide, allowing for easy coupling to microspheres or other surfaces for use in various experimental setups. Its immunosuppressant properties make it a valuable tool in understanding the role of myoglobin in different physiological processes. Trust the Myoglobin antibody for accurate and reliable results in your research endeavors.</p>

<p>Rat monoclonal Toll-like receptor 4 antibody (allophycocyanin)</p>

<p>CHUK antibody was raised in Mouse using a purified recombinant fragment of human CHUK expressed in E. coli as the immunogen.</p>

<p>LRFN3 antibody was raised using the C terminal of LRFN3 corresponding to a region with amino acids VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS</p>

<p>Purified recombinant Human MAFK protein (His tag)</p>

<p>WNT3 alpha antibody was raised in rabbit using highly pure recombinant human WNT-3-alpha as the immunogen.</p>

<p>PRPH antibody was raised using the N terminal of PRPH corresponding to a region with amino acids RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE</p>

<p>GLMN antibody was raised using the N terminal of GLMN corresponding to a region with amino acids AVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQN</p>