Produits biochimiques et réactifs

<p>LONRF3 antibody was raised using the middle region of LONRF3 corresponding to a region with amino acids LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF560 antibody, catalog no. 70R-8135</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCMTD1 antibody, catalog no. 70R-1075</p>

<p>Calponin 2 antibody was raised using the N terminal of CNN2 corresponding to a region with amino acids YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC</p>

<p>Purified Polyclonal M Cadherin antibody</p>

<p>KIF22 antibody was raised in mouse using recombinant Human Kinesin Family Member 22 (Kif22)</p>

<p>RFPL3 antibody was raised using the C terminal of RFPL3 corresponding to a region with amino acids TVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPL</p>

<p>Rabbit polyclonal GNAL antibody</p>

<p>Phenobarbital antibody was raised in mouse using phenobarbital-KLH conjugate as the immunogen.</p>

<p>Purified recombinant PSMB8 protein</p>

<p>Rabbit Polyclonal EPS15L1 antibody</p>

<p>Mouse monoclonal SCHIP1 antibody</p>

<p>Mouse monoclonal C17orf37 antibody</p>

<p>Mouse monoclonal CD5 antibody (FITC)</p>

<p>TUJ1 antibody was raised in rabbit using residues 433-450 EGEMYEDDEEESEAQGPK of the 50 kDa human beta-tubulin-III protein as the immunogen.</p>

<p>MIS12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKI</p>

<p>GSTA3 antibody was raised in Rabbit using Human GSTA3 as the immunogen</p>

<p>Rabbit polyclonal MMP15 antibody (Tyr132)</p>

<p>1-132 amino acids: MGSSHHHHHH SSGLVPRGSH MAFDSTWKVD RSENYDKFME KMGVNIVKRK LAAHDNLKLT ITQEGNKFTV KESSAFRNIE VVFELGVTFN YNLADGTELR GTWSLEGNKL IGKFKRTDNG NELNTVREII GDELVQTYVY EGVEAKRIFK KD</p>

<p>MDC antibody was raised in rabbit using highly pure recombinant murine MDC as the immunogen.</p>

<p>Synapsin 1 antibody is a highly specialized Polyclonal Antibody that plays a crucial role in endothelial growth and development. This antibody is widely used in the field of Life Sciences to study various cellular processes and identify specific cell antigens. The high viscosity of this antibody ensures efficient binding to target molecules, providing accurate and reliable results.</p>

<p>Sepimostat dimethanesulfonate is a peptide that acts as an inhibitor of ion channels and receptor proteins. It is used as a research tool for the study of protein interactions, cell biology, and pharmacology. Sepimostat dimethanesulfonate binds to receptors and ligands with high affinity, preventing them from binding to their corresponding proteins. This drug has been shown to inhibit the activity of potassium channels and calcium channels in cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ST8SIA2 antibody, catalog no. 70R-7133</p>

<p>Purified Polyclonal EPB41L2 antibody</p>

<p>The Mouse IgG2a Isotype Control is a monoclonal antibody that serves as an isotype control for experimental purposes. It is used in various life science research applications to ensure accurate and reliable results. This isotype control does not specifically bind to any antigen or target, making it an ideal control for experiments involving antibodies.</p>

<p>Adenovirus antibody was raised in mouse using hexon group antigen of numerous ADV as the immunogen.</p>

<p>The BclxL antibody is a monoclonal antibody that belongs to the class of anti-acth antibodies. It is widely used in Life Sciences research for its ability to detect and target the BclxL protein, a key regulator of apoptosis. This antibody has been shown to exhibit cytotoxic activity against cancer cells by inducing apoptosis through the inhibition of BclxL function. Additionally, it has been found to have inhibitory effects on chemokine and TGF-beta signaling pathways, which play crucial roles in inflammation and immune response. The BclxL antibody can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. Its high specificity and affinity make it a valuable tool for studying the role of BclxL in cell survival and growth regulation.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is widely recognized as one of the most effective treatments for tuberculosis infections. This compound exhibits strong bactericidal activity by binding to DNA-dependent RNA polymerase, thus inhibiting bacterial growth and replication. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets Mycobacterium tuberculosis strains and impedes their cell growth in culture.</p>

<p>Purified Polyclonal ZNF25 antibody</p>

<p>PAM antibody was raised using the N terminal of PAM corresponding to a region with amino acids PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL</p>

<p>The GFP antibody is an essential tool in Life Sciences research. It is a monoclonal antibody that specifically binds to Green Fluorescent Protein (GFP), a protein commonly used as a molecular marker in various experimental techniques. This antibody has been extensively validated for its high specificity and sensitivity in detecting GFP-tagged proteins.</p>

<p>SPAG11B antibody was raised using the N terminal of SPAG11B corresponding to a region with amino acids MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG</p>

<p>The PECAM1 antibody is a highly specialized monoclonal antibody derived from a hybridoma cell line. It is designed to target and neutralize the growth factor receptor protein known as platelet endothelial cell adhesion molecule 1 (PECAM1). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Mouse monoclonal LEMD3 antibody</p>

<p>Purified Polyclonal CREG1 antibody</p>

<p>Hemopexin antibody was raised against Human Hemopexin.</p>

<p>Rabbit polyclonal CRGF antibody (biotin)</p>

<p>Purified recombinant PCMTD1 protein (His tag)</p>

<p>The RHBDD1 antibody is a monoclonal antibody specifically designed to target insulin. It is commonly used in research and diagnostic applications for the detection and analysis of insulin levels. This antibody has been extensively validated using mass spectrometry methods and has shown high specificity and sensitivity in detecting insulin in various samples, including human serum. The RHBDD1 antibody is derived from a hybridoma cell line and is produced using recombinant human insulin as an antigen. Its unique binding properties enable accurate measurement of insulin levels, making it an essential tool in the field of Life Sciences. Whether you are studying hyperinsulinaemic hypoglycaemia or investigating insulin-related disorders, this mouse monoclonal antibody can provide reliable results. With its ability to recognize specific acid residues on insulin, the RHBDD1 antibody offers precise and consistent performance for insulin detection. Trust this high-quality antibody for your research needs and unlock new insights into the role of insulin in various physiological processes.</p>

<p>RAD17 antibody was raised in rabbit using residues 10-23 [STKRSLKKKKIRKI] of the S. pombe RAD17 75 kDA protein as the immunogen.</p>

<p>Rabbit polyclonal SERPINA10 antibody</p>

<p>PTPMT1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>ZNF19 antibody was raised using the N terminal of ZNF19 corresponding to a region with amino acids TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE</p>

<p>Rabbit polyclonal CHOP antibody (Ser30)</p>

<p>Rabbit Polyclonal STAM2 antibody</p>

<p>The NGAL antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is commonly employed in transfer reactions and immunoassays to detect and quantify NGAL (neutrophil gelatinase-associated lipocalin) levels in various biological samples. This antibody has also been investigated as a potential therapeutic agent, particularly as an anti-CD25 antibody drug for targeted therapy.</p>

<p>LCOR antibody was raised in rabbit using the C terminal of LCOR as the immunogen</p>

<p>NR4A3 antibody was raised using the middle region of NR4A3 corresponding to a region with amino acids KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN</p>

<p>UBE2L3 antibody was raised using the middle region of UBE2L3 corresponding to a region with amino acids WQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQ</p>

<p>Rabbit polyclonal TPPP3 antibody</p>