Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.118 produits)
- Par Biological Target(99.156 produits)
- Par usage/effets pharmacologiques(6.788 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.748 produits)
- Métabolites secondaires(14.233 produits)
130579 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
ETS1 antibody
<p>ETS1 antibody is a growth factor that targets tyrosine residues on proteins. It can be used in combination with other antibodies, such as trastuzumab (anti-HER2 antibody), to inhibit the growth of cancer cells. ETS1 antibody binds to the epidermal growth factor receptor and prevents the activation of downstream signaling pathways that promote cell proliferation. This monoclonal antibody specifically recognizes the amino and carbonyl groups on ETS1 protein, allowing for highly specific binding. ETS1 antibody is commonly used in Life Sciences research, particularly in studies involving antibodies and their interactions with various proteins. It has also been shown to have potential therapeutic applications, such as targeting lipoprotein lipase or CD33 on mesenchymal stem cells.</p>RPS6KA4 antibody
<p>RPS6KA4 antibody was raised in mouse using recombinant Human Ribosomal Protein S6 Kinase, 90Kda, Polypeptide 4 (Rps6Ka4)</p>Chlamydia trachomatis antibody
<p>Chlamydia trachomatis antibody was raised in goat using purified MOMP from strain L2 as the immunogen.</p>Degré de pureté :Min. 95%Tenascin C antibody
<p>The Tenascin C antibody is a highly specialized product used in the field of Life Sciences. It is an activated glycoprotein that acts as a growth factor and plays a crucial role in various cellular processes. This antibody is widely used in immunoassays, particularly in the detection and quantification of Tenascin C levels.</p>Influenza B antibody
<p>Influenza B antibody is a neutralizing monoclonal antibody that specifically targets the influenza B virus. It works by binding to the hemagglutinin protein on the surface of the virus, preventing it from infecting host cells. This antibody has been shown to be effective in inhibiting viral replication and reducing the severity of symptoms associated with influenza B infection.</p>KRT19 antibody
<p>The KRT19 antibody is a highly specialized product used in the field of Life Sciences. It is an activated antibody that specifically targets and binds to the KRT19 protein. This protein is commonly associated with various diseases, including Helicobacter infections.</p>CD28 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD28 antibody, catalog no. 70R-9669</p>Degré de pureté :Min. 95%MASH1 antibody
<p>The MASH1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and inhibits the growth factor MASH1. This antibody has been extensively studied and proven to be highly effective in blocking the activity of MASH1, making it an invaluable tool for researchers studying the role of this growth factor in various biological processes.</p>Degré de pureté :Min. 95%SLC25A21 antibody
<p>SLC25A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGL</p>Degré de pureté :Min. 95%Troponin I protein (Cardiac) (Bovine)
<p>Purified native Bovine Troponin I protein (Cardiac)</p>Degré de pureté :Min. 95%PCGF4 antibody
<p>PCGF4 antibody was raised in rabbit using the C terminal of PCGF4 as the immunogen</p>Degré de pureté :Min. 95%MYL2 antibody
<p>MYL2 antibody was raised in mouse using recombinant human MYL2 (1-166aa) purified from E. coli as the immunogen.</p>CTIP antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. Extensive research has demonstrated its high efficacy, with studies conducted using a patch-clamp technique on human erythrocytes.</p>ATE1 antibody
<p>ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM</p>FAM55D antibody
<p>FAM55D antibody was raised using the C terminal of FAM55D corresponding to a region with amino acids TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK</p>TNFRSF21 antibody
<p>TNFRSF21 antibody was raised using the N terminal of TNFRSF21 corresponding to a region with amino acids TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV</p>Degré de pureté :Min. 95%TPSAB1 antibody
<p>The TPSAB1 antibody is a biomolecule that belongs to the class of polyclonal antibodies. It specifically targets and binds to the epidermal growth factor, which is a nuclear-activated protein involved in various biological processes. This antibody is widely used in the field of Life Sciences for research purposes, particularly in studies related to epidermal growth and its role in cell signaling pathways.</p>Sparfosate sodium
CAS :<p>Sparfloxacin is a peptide that is used as a research tool in cell biology and pharmacology. It binds to the anti-sigma factor, which is involved in the regulation of ribosomal RNA (rRNA) synthesis. This binding prevents the formation of an rRNA transcription complex with the 50S ribosomal subunit, inhibiting protein synthesis and cell division. Sparfloxacin can also inhibit ion channels by binding to their ligand-binding sites, reducing the flow of ions through these channels.</p>Formule :C6H8NNa2O8PDegré de pureté :Min. 95%Masse moléculaire :299.08 g/molCELSR3 antibody
<p>CELSR3 antibody is a powerful antiviral agent that targets the lipoprotein lipase, a key enzyme involved in viral replication. This monoclonal antibody acts as a medicament by neutralizing the growth factor required for viral proliferation. The colloidal nature of this antibody allows for efficient targeting and binding to specific viral particles. Additionally, CELSR3 antibody exhibits high specificity towards the CD20 antigen, making it an effective therapeutic option for diseases characterized by abnormal CD20 expression. Its unique glycosylation pattern and fatty acid modifications enhance its stability and prolong its half-life in circulation. With its potent antiviral properties and precise targeting capabilities, CELSR3 antibody is a promising tool in the field of life sciences for combating viral infections.</p>GLPG 0974
CAS :<p>GLPG 0974 is an experimental pharmaceutical compound, specifically an antagonist of the free fatty acid receptor 2 (FFA2), also known as GPR43. This compound is synthesized through a process of chemical engineering aimed at selectively inhibiting GPR43's activity. The mode of action involves blocking the interaction of short-chain fatty acids with GPR43, a receptor implicated in inflammatory pathways.</p>Formule :C25H25ClN2O4SDegré de pureté :Min. 95%Masse moléculaire :485 g/molHDLBP antibody
<p>HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMV</p>RABL4 antibody
<p>RABL4 antibody was raised using the C terminal of RABL4 corresponding to a region with amino acids RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA</p>Degré de pureté :Min. 95%TRIM72 antibody
<p>TRIM72 antibody was raised using the middle region of TRIM72 corresponding to a region with amino acids LEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAH</p>Mouse Lymphocyte antibody
<p>Mouse lymphocyte antibody was raised in rabbit using RBC-free rannit thymus and spleen cells as the immunogen.</p>Degré de pureté :Min. 95%Glycogen Synthase antibody
<p>The Glycogen Synthase antibody is a growth factor that plays a crucial role in various biological processes. It belongs to the class of antibodies and binding proteins that are involved in immunomodulation. This antibody has been shown to have cytotoxic and antiviral properties, making it a potential candidate for the development of anticancer agents and antiviral therapies. The Glycogen Synthase antibody can neutralize specific targets by binding to specific epitopes on their surface, thereby inhibiting their activity. With its polyclonal and monoclonal variants, this antibody offers a wide range of applications in Life Sciences research and clinical settings.</p>KLF4 antibody
<p>The KLF4 antibody is a powerful tool used in Life Sciences for ultrasensitive detection and analysis. It is designed to specifically target and bind to the KLF4 protein, which plays a crucial role in cell growth and development. This monoclonal antibody can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.</p>KIFAP3 antibody
<p>KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG</p>ARR3 antibody
<p>ARR3 antibody was raised in rabbit using the middle region of ARR3 as the immunogen</p>Degré de pureté :Min. 95%KLHL13 antibody
<p>KLHL13 antibody was raised in Mouse using a purified recombinant fragment of human KLHL13 expressed in E. coli as the immunogen.</p>
