Produits biochimiques et réactifs

<p>BAD antibody is a polyclonal antibody that targets the BAD protein, which plays a crucial role in regulating apoptosis (cell death) in adipose tissue. This antibody can be used as an inhibitor to study the function of BAD in adipocytes and other cell types. Additionally, it can be used as a research tool in the field of life sciences to investigate the mechanisms underlying cell death and survival. The BAD antibody is available as both polyclonal and monoclonal antibodies, offering researchers different options based on their specific needs. It has been shown to have neutralizing effects on the activity of BAD, making it a valuable tool for studying its function in various cellular processes.</p>

<p>Purified recombinant RPS19 protein (His tag)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. It is highly effective in treating tuberculosis infection due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication. Its potency has been demonstrated through various techniques such as the patch-clamp technique on human erythrocytes. The drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>Rabbit polyclonal SMAD2 antibody (Ser467)</p>

<p>BTN3A3 antibody was raised in Rabbit using Human BTN3A3 as the immunogen</p>

<p>The TGFB2 antibody is a highly specialized antibody that targets the protein transforming growth factor beta 2 (TGFB2). It belongs to the class of antibodies known as polyclonal antibodies, which are produced by multiple B cell clones and can recognize different epitopes on the target antigen. This antibody is widely used in life sciences research to study the role of TGFB2 in various biological processes.</p>

<p>Rabbit polyclonal FOXO1A antibody</p>

<p>SFRS12IP1 antibody was raised using the middle region of SFRS12IP1 corresponding to a region with amino acids NEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKE</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Purified Rabbit polyclonal FOXL2 antibody (Ser263)</p>

<p>PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ</p>

<p>ADNP antibody was raised in rabbit using human 114 kDA hADNP protein as the immunogen.</p>

<p>SCN1B antibody was raised using the middle region of SCN1B corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS</p>

<p>The GAD67 antibody is a polyclonal antibody that targets autoantibodies against the enzyme glutamate decarboxylase 67 (GAD67). This antibody is commonly used in Life Sciences research to study the role of GAD67 in various biological processes. It can be used for applications such as immunohistochemistry, Western blotting, and ELISA.</p>

<p>Apogossypol is a heterocyclic molecule that has been shown to have anti-cancer effects. It binds to the mitochondrial enzyme p-nitrophenyl phosphate, which inhibits the production of ATP and induces apoptosis in cancer cells. Apogossypol also has demonstrated efficacy against autoimmune diseases, including multiple sclerosis and type 1 diabetes, by inhibiting inflammatory cytokine production. Apogossypol has been shown to induce caspase-independent cell death in fetal bovine kidney cells and carcinoma cell lines. This effect is mediated by increased levels of the protein MCL-1.</p>

<p>Rabbit polyclonal ERK8 antibody (Thr175+Tyr177)</p>

<p>Rabbit polyclonal WRN antibody (Ser1141)</p>

<p>Mouse monoclonal CAPN9 antibody</p>

<p>Rabbit polyclonal SLCO2A1 antibody</p>

<p>EHMT2 antibody was raised in rabbit using the N terminal of EHMT2 as the immunogen</p>

<p>MCP2 antibody was raised in rabbit using recombinant human MCP-2 as the immunogen.</p>

<p>The SNAP25 antibody is a monoclonal antibody that specifically targets clostridial neurotoxins. It is widely used in the field of Life Sciences for research purposes. This antibody has been shown to effectively neutralize the effects of clostridial neurotoxins by binding to them and preventing their interaction with target cells. The SNAP25 antibody is highly specific and does not cross-react with other proteins or molecules commonly found in biological samples. It has been extensively tested in various sample matrices, including human serum, and has shown excellent performance. Additionally, this antibody has been proven to be stable under different storage conditions and retains its activity even after multiple freeze-thaw cycles. Researchers rely on the SNAP25 antibody for its reliability and accuracy in detecting and quantifying clostridial neurotoxins in their experiments.</p>

<p>Rabbit polyclonal TNNI3 antibody (Ser22+Ser23)</p>

<p>Rabbit polyclonal Tubulin alpha antibody</p>

<p>The beta Tubulin antibody is a highly specific monoclonal antibody that targets the beta-tubulin protein. This protein plays a crucial role in cell division and is essential for the formation of microtubules, which are involved in various cellular processes such as intracellular transport and cell shape maintenance.</p>

<p>The ID3 antibody is a monoclonal antibody that specifically targets and binds to the protein ID3. This protein is involved in cholinergic signaling and plays a crucial role in various cellular processes. The ID3 antibody can be used for research purposes, such as studying the function of ID3 in different cell types or investigating its role in disease development.</p>

<p>Synthetic human phosphopeptide nNOS (Ser847) region immunogen, Rabbit polyclonal nNOS antibody (Ser852)</p>

<p>Armenian Hamster monoclonal CCL2 antibody (PE)</p>

<p>OSBPL3 antibody was raised using the N terminal of OSBPL3 corresponding to a region with amino acids MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE</p>

<p>Rabbit polyclonal USP3 antibody</p>

<p>C4BPB antibody was raised in Rabbit using Human C4BPB as the immunogen</p>

<p>Rabbit polyclonal PUS3 antibody</p>

<p>Rabbit polyclonal WEE1 antibody (Ser53)</p>

<p>CD86 antibody was raised in Mouse using a purified recombinant fragment of human CD86 expressed in E. coli as the immunogen.</p>

<p>Sheep Red Blood Cells are an essential component in various scientific and medical research applications. These cells are commonly used in the development of monoclonal antibodies, particularly those targeting glial fibrillary acidic protein (GFAP). Additionally, Sheep Red Blood Cells have been utilized in studies involving collagen, antiviral interferon, and other life sciences research.</p>

<p>Rabbit polyclonal ZNF395 antibody</p>

<p>The SUFU antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers and scientists working in various applications such as flow immunoassays, electrochemical impedance, and crystal microbalance studies. This antibody is available in both monoclonal and polyclonal forms, providing flexibility and options for different experimental needs.</p>

<p>The BRDU antibody is a highly effective medicament that belongs to the class of activated monoclonal antibodies. It specifically targets the nuclear glycoprotein, e-cadherin, and inhibits its expression. This antibody is widely used in Life Sciences for various biochemical studies and research purposes. It is commonly employed in experiments involving the detection and quantification of cell proliferation and DNA synthesis. The BRDU antibody is a valuable tool for scientists and researchers working in fields such as cancer biology, immunology, and developmental biology. With its exceptional specificity and reliability, this monoclonal antibody is an essential component of any laboratory's toolkit.</p>

<p>Mouse monoclonal NDEL1 antibody</p>

<p>The PDLIM2 antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to target and detect e-cadherin expression, a protein involved in cell adhesion and signaling. This antibody is ideal for researchers and scientists working on projects related to e-cadherin, as it allows for precise detection and analysis.</p>

<p>Rabbit polyclonal UBR7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOH11CR2A antibody, catalog no. 70R-9303</p>

<p>The AK1 antibody is a highly specialized monoclonal antibody that targets the amino group in nuclear extracts. It has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth of cancer cells. This antibody specifically targets interferon and growth factor receptors, making it a valuable tool for researchers studying these pathways. In addition, the AK1 antibody has been used in combination with other monoclonal antibodies such as trastuzumab to enhance their therapeutic effects. Its unique lysine-specific binding properties make it an ideal choice for various applications, including spectrometric analysis and electrode-based assays. Whether you are conducting research or developing new therapies, the AK1 antibody is a powerful tool that can help you achieve your goals.</p>

<p>Rabbit polyclonal SYNPO2L antibody</p>

<p>Purified recombinant PABPC1 protein (His tag)</p>

<p>The TAU antibody is a diagnostic agent used in immunochemical studies to detect the presence of TAU protein. It is particularly useful in detecting abnormal levels of TAU protein in human serum, cerebrospinal fluid, and primary neuron cultures. The TAU antibody specifically binds to TAU protein and can be used for the identification and quantification of TAU protein in various biological samples. This monoclonal antibody has high affinity and specificity for TAU protein, making it an excellent tool for research purposes. Whether you're studying synaptic proteins or investigating neurodegenerative diseases characterized by the accumulation of amyloid plaques, the TAU antibody is a valuable asset in your scientific arsenal.</p>

<p>SNRPA antibody was raised in rabbit using the N terminal of SNRPA as the immunogen</p>

<p>Rabbit polyclonal LN28A antibody</p>

<p>The ACAD10 antibody is a highly specialized antibody used in the field of Life Sciences. It has been extensively studied and proven to be effective in various applications. This antibody specifically targets elastase, a protease enzyme involved in numerous biological processes. It has been shown to inhibit elastase activity, thereby preventing its harmful effects on human serum components.</p>

<p>PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKI</p>