Produits biochimiques et réactifs

<p>Rabbit polyclonal TMEM30B antibody</p>

<p>NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV</p>

<p>NARF antibody was raised using the middle region of NARF corresponding to a region with amino acids FRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDH24 antibody, catalog no. 70R-6134</p>

<p>Rabbit polyclonal PLAU antibody (FITC)</p>

<p>Rabbit polyclonal FOXC1/2 antibody</p>

<p>Goat anti-human IgG (H + L) (Fab'2) (rhodamine) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>Region of CTACK protein corresponding to amino acids FLLPPSTACC TQLYRKPLSD KLLRKVIQVE LQEADGDCHL QAFVLHLAQR SICIHPQNPS LSQWFEHQER KLHGTLPKLN FGMLRKMG.</p>

<p>The Beta Lactoglobulin antibody is a polyclonal antibody that is immobilized and used as an inhibitor of CD20 antibodies. It specifically targets the beta lactoglobulin antigen, which is a glycoprotein found in milk. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. It can be used in various applications, including research on proproteins, monoclonal antibodies, antibody-drug conjugates, cytotoxicity assays, chemokine studies, and the production of recombinant proteins. With its high specificity and affinity for the target antigen, the Beta Lactoglobulin antibody offers great potential for advancing scientific discoveries in various fields.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD7 antibody, catalog no. 70R-5085</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R5E antibody, catalog no. 70R-9425</p>

<p>Rabbit polyclonal PITPNM1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NXF5 antibody, catalog no. 70R-8491</p>

<p>Rabbit polyclonal CD97 beta antibody (Ser531)</p>

<p>Purified recombinant Human BCL10 Protein (His tag)</p>

<p>Rabbit polyclonal TOPK antibody (Thr9)</p>

<p>NHP2L1 antibody was raised in Rabbit using Human NHP2L1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPN2 antibody, catalog no. 70R-6845</p>

<p>Vimentin antibody was raised in sheep using purified recombinant human vimentin produced in bacteria as the immunogen.</p>

<p>Rabbit polyclonal Tumor necrosis factor antibody (FITC)</p>

<p>Purified recombinant Human RBP7 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of G22P1 antibody, catalog no. 70R-1051</p>

<p>FAH antibody was raised using a synthetic peptide corresponding to a region with amino acids SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT</p>

<p>Rabbit Polyclonal SAR1B antibody</p>

<p>Rabbit polyclonal IKB alpha antibody (Ser32/Ser36)</p>

<p>The FIR antibody is a polyclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the botulinum toxin, making it an essential tool for research and diagnostic purposes. This antibody has been extensively tested and proven to be highly effective in detecting and quantifying the presence of botulinum toxin in various samples. The FIR antibody can be used in combination with other monoclonal antibodies to enhance its cytotoxic effects, allowing for more accurate and reliable results. Its unique composition and high specificity make it an invaluable asset in the fight against botulinum toxin-related diseases. Additionally, this antibody has shown promising results as an anti-Mertk antibody, which makes it a potential candidate for developing novel therapies targeting Mertk family kinases. With its wide range of applications and exceptional performance, the FIR antibody is a must-have tool for any researcher or scientist working in the field of botulinum toxin research.</p>

<p>Recombinant human KPNA2 protein (His tag)</p>

<p>KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI</p>

<p>Rabbit polyclonal EID1 antibody</p>

<p>Rabbit polyclonal EIF4A2 antibody (FITC)</p>

<p>The CD147 antibody is a highly specialized monoclonal antibody that has a wide range of applications in the field of Life Sciences. It is commonly used to study the role of CD147, also known as Basigin or EMMPRIN, in various cellular processes. This antibody specifically targets CD147 and can be used for neutralizing or inhibitory purposes.</p>

<p>Rabbit polyclonal 5HT1A antibody</p>

<p>EIF1AD antibody was raised in Rabbit using Human EIF1AD as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL3 antibody, catalog no. 70R-2890</p>

<p>Noggin antibody was raised using the middle region of NOG corresponding to a region with amino acids GGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEI</p>

<p>Purified Hamster IgG HRP conjugate</p>

<p>Desmoyokin antibody was raised in Guinea Pig using synthetic peptides of human desmoyokin coupled to KLH as the immunogen.</p>

<p>Rabbit polyclonal RPL6 antibody</p>

<p>Rabbit polyclonal IL10Ra antibody (Tyr496)</p>

<p>The MAEA antibody is a polyclonal antibody that targets the MAEA protein. This antibody has been widely used in various life sciences research applications, including hybridization studies, immunoassays, and Western blotting. The MAEA antibody has shown neutralizing activity against insulin and leukemia inhibitory factor (LIF), making it a valuable tool for studying the role of these factors in cell signaling pathways. Additionally, this antibody has been used in studies investigating the effects of fatty acids, hepatocyte growth factor (HGF), epidermal growth factor (EGF), and insulin on cellular processes. The MAEA antibody is available conjugated to different labels, such as biotin or streptavidin, allowing for easy detection and visualization in experimental setups. With its versatility and high specificity, the MAEA antibody is an essential tool for researchers in the field of life sciences.</p>

<p>Capping Protein beta 3 antibody was raised in Guinea Pig using synthetic N-terminal domain of bovine F-actin Beta 3 subunit capping protein coupled to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NSDHL antibody, catalog no. 70R-1783</p>

<p>ANKRD1 antibody was raised in Rabbit using Human ANKRD1 as the immunogen</p>

<p>Meis3 antibody was raised in rabbit using the C terminal of Meis3 as the immunogen</p>

<p>Rabbit polyclonal HER2 antibody (Tyr1221/Tyr1222)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CAP1 antibody, catalog no. 70R-5729</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC1A1 antibody, catalog no. 70R-6796</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Ascc1 antibody, catalog no. 70R-9441</p>

<p>Rabbit polyclonal PAFAH2 antibody</p>

<p>Ubiquilin 1 antibody was raised using the middle region of UBQLN1 corresponding to a region with amino acids QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA</p>