Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.185 produits)
- Par Biological Target(99.150 produits)
- Par usage/effets pharmacologiques(6.789 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.764 produits)
- Métabolites secondaires(14.307 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
SIV mac251 gp120 antibody (biotin)
<p>Rabbit polyclonal SIV gp 120 antibody (biotin); full SIV1 mac251 gp120 immunogen</p>Praluzatamab
CAS :<p>Anti-activated leukocyte cell adhesion mlecule (ALCAM/CD116) monoclonal antibody</p>H-RLAVYQAGAR^-OH
<p>Peptide H-RLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CD4 (T cell receptor) antibody (FITC)
<p>Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 50 ug/vial; clone 4</p>Estradiol 6 antibody
<p>Estradiol-6 antibody was raised in rabbit using 17 beta-Estradiol-6-BSA as the immunogen.</p>Degré de pureté :Min. 95%HSV1 gC antibody
<p>HSV1 gC antibody was raised in mouse using herpes simplex virus gC-1 as the immunogen.</p>Vitamin B12 antibody
<p>Vitamin B12 antibody was raised in rabbit using Vitamin B12-BSA as the immunogen.</p>Histone H3 antibody
<p>Histone-H-3 antibody was raised in sheep using Intact calf histone H3 complexed with RNA as the immunogen.</p>Degré de pureté :Min. 95%CD4 protein
<p>The CD4 protein is a glycoprotein that plays a crucial role in the immune system. It is primarily found on the surface of helper T cells, which are a type of white blood cell involved in coordinating immune responses. The CD4 protein acts as a receptor for the HIV virus, allowing it to enter and infect host cells.</p>Degré de pureté :>95% By Sds-Page.HIV1 gp41 antibody (FITC)
<p>Mouse monoclonal HIV1 gp41 antibody (FITC); immunogen HIV gp41; IgG1</p>Progesterone 3 antibody
<p>Progesterone 3 antibody was raised in rabbit using progesterone 3-CMO-BSA as the immunogen.</p>Degré de pureté :With Sensitivity ToHRP Goat Anti Alpaca IgG, VHH domain HRP
<p>Please enquire for more information about HRP Goat Anti Alpaca IgG, VHH domain HRP including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Ebola Virus antibody
<p>The Ebola Virus antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody is specifically designed to target and neutralize the glycoprotein of the Ebola virus. It has been extensively tested and proven to be highly effective in detecting and binding to the virus, making it an essential component in research and diagnostics related to Ebola.</p>H-GLDSEESYPYEAK^^-OH
<p>Peptide H-GLDSEESYPYEAK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CKMM antibody
<p>CKMM antibody was raised in goat using human skeletal muscle purified CK-MM Isoenzyme as the immunogen.</p>Degré de pureté :Min. 95%Estradiol antibody
<p>Estradiol antibody was raised in rabbit using estradiol-6-protein preparation as the immunogen.</p>HIV1 p24 antibody
<p>HIV1 p24 antibody was raised in goat using p24 (HIV-1 IIIB) as the immunogen.</p>Degré de pureté :Min. 95%HIV1 gp41 antibody (HRP)
<p>HIV1 gp41 antibody (HRP) was raised in mouse using purified, full length Recombinant gp41 (HIV-1) produced in E. coli expression system as the immunogen.</p>NFkB regulatory factor antibody
<p>Rabbit polyclonal NFkB regulatory factor antibody</p>Degré de pureté :Min. 95%CD4 antibody
<p>CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.</p>Human Growth Hormone antibody
<p>human Growth Hormone antibody was raised in rabbit using human growth hormone as the immunogen.</p>HIV1 gp120 antibody
<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>IFN α ELISA Kit
<p>ELISA kit for detection of IFN Alpha in the research laboratory</p>Degré de pureté :Min. 95%E. coli antibody
<p>E. coli antibody was raised in mouse using E. coli shigatoxin as the immunogen.</p>Degré de pureté :Min. 95%TAPI-2
<p>Peptide TAPI-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>cAMP antibody
<p>cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.</p>Degré de pureté :Min. 95%Aldosterone 3 antibody
<p>Aldosterone-3 antibody was raised in rabbit using aldosterone-3-BSA as the immunogen.</p>Degré de pureté :Min. 95%CKBB antibody
<p>CKBB antibody was raised in rabbit using human CKBB from the brain as the immunogen.</p>Degré de pureté :Min. 95%CEA antibody
<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>Oxyphenbutazone antibody
<p>Oxyphenbutazone antibody was raised in rabbit using oxyphenbutazone-KLH as the immunogen.</p>Degré de pureté :Min. 95%H-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH
<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>SLE IgG Positive Human Plasma
<p>SLE IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SLE IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>H-NSLFEYQK^-OH
<p>Peptide H-NSLFEYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
