Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.185 produits)
- Par Biological Target(99.150 produits)
- Par usage/effets pharmacologiques(6.789 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.764 produits)
- Métabolites secondaires(14.307 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
HIV1 gp41 antibody (HRP)
<p>HIV1 gp41 antibody (HRP) was raised in mouse using purified, full length Recombinant gp41 (HIV-1) produced in E. coli expression system as the immunogen.</p>FSH β antibody
<p>FSH Beta antibody was raised in rabbit using FSH beta-KLH as the immunogen.</p>Degré de pureté :Min. 95%Theophylline antibody
<p>Theophylline antibody was raised in mouse using theophylline as the immunogen.</p>Bombesin antibody
<p>Bombesin antibody was raised in rabbit using Bombesin-BSA as the immunogen.</p>Degré de pureté :Min. 95%HIV1 protease IIIB protein (HRP)
<p>Purified recombinant HIV1 protease IIIB (HRP)</p>Degré de pureté :Min. 95%CD4 antibody
<p>CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.</p>HIV1 p24 antibody
<p>HIV1 p24 antibody was raised in rabbit using full length recombinant p24 expressed in baculovirus expression system as the immunogen.</p>Degré de pureté :Min. 95%Trypsin antibody
<p>Trypsin antibody was raised in rabbit using human pancreatic trypsin as the immunogen.</p>Degré de pureté :Min. 95%hCG beta antibody
<p>hCG beta antibody was raised in rabbit using HCG beta-KLH as the immunogen.</p>Degré de pureté :Min. 95%Measles Virus Nucleoprotein antibody (FITC)
<p>Mouse monoclonal Measles Virus Nucleoprotein antibody (FITC)</p>HIV1 Nef antibody
<p>HIV1 Nef antibody was raised in mouse using full length nef (HIV-1, ELI) as the immunogen.</p>SIV mac251 gp120 antibody (biotin)
<p>Rabbit polyclonal SIV gp 120 antibody (biotin); full SIV1 mac251 gp120 immunogen</p>CRP antibody
<p>CRP antibody was raised in mouse using highly pure immuno grade C-RP as the immunogen.</p>HIV1 integrase antibody
<p>HIV1 integrase antibody was raised in mouse using full length recombinant Integrase (HIV-1, IIIB) as the immunogen.</p>CA 125 ELISA kit
<p>CA 125 ELISA kit for detection of CA125 in the research laboratory</p>Degré de pureté :Min. 95%HIV1 gp41 antibody (biotin)
<p>Mouse monoclonal HIV1 gp41 antibody (biotin); immunogen recombinant gp41; IgG1; Supplied in lyophilized form in PBS buffer</p>CMVpp65 - 70 (PKNMIIKPGKISHIM)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,707.2 g/molAndrostenedione antibody
<p>Androstenedione antibody was raised in rabbit using 4-androstene 3, 17-dione-11-protein conjugate as the immunogen.</p>Degré de pureté :Min. 95%Luteinizing Hormone antibody
<p>Luteinizing hormone antibody was raised in goat using human pituitary LH as the immunogen.</p>HPV11 antibody
<p>HPV11 antibody was raised in mouse using papilloma virus type 11 as the immunogen.</p>Intrinsic Factor antibody
<p>Intrinsic Factor antibody was raised in rabbit using intrinsic factor as the immunogen.</p>Folic Acid antibody
<p>Folic acid antibody was raised in rabbit using folic acid-BSA as the immunogen.</p>HSV1 gE antibody
<p>HSV1 gE antibody was raised in mouse using herpes simplex virus I glycoprotein E (gE) as the immunogen.</p>CD4 (T cell receptor) antibody (biotin)
<p>Mouse monoclonal CD4 antibody (biotin); IgG1; 50 ug/vial; clone 45</p>Bovine Growth Hormone antibody
<p>BGH antibody was raised in rabbit using bovine growth hormone as the immunogen.</p>Degré de pureté :Min. 95%HIV1 tat antibody
<p>The HIV1 tat antibody is a protein that belongs to the oncostatin and natriuretic family. It acts as a kinase inhibitor and is available as both a monoclonal antibody and polyclonal antibodies in the field of Life Sciences. This antibody specifically targets the tat protein of HIV-1, which plays a crucial role in viral replication and immune evasion. By binding to the tat protein, this antibody inhibits its function and prevents viral replication.</p>Degré de pureté :Min. 95%Mumps virus antibody
<p>Mumps virus antibody was raised in mouse using mumps virus as the immunogen.</p>HSV1 + HSV2 ICP35 antibody
<p>HSV1 + HSV2 ICP35 antibody was raised in mouse using herpes simplex virus ICP35 as the immunogen.</p>Furosemide antibody
<p>Furosemide antibody was raised in rabbit using furosemide-KLH as the immunogen.</p>Degré de pureté :Min. 95%AFP antibody
<p>AFP antibody was raised in goat using human AFP from cord serum as the immunogen.</p>PTH antibody
<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>Degré de pureté :Min. 95%SIV mac251 p28 antibody
<p>SIV mac251 p28 antibody was raised in rabbit using full length recombinant p28 (SIVmac251) as the immunogen.</p>Degré de pureté :Min. 95%Cocaine antibody
<p>Cocaine antibody was raised in goat using cocaine-KLH as the immunogen.</p>Degré de pureté :Min. 95%HIV1 gp120 antibody
<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>Degré de pureté :Min. 95%HIV2 p26 antibody
<p>Rabbit polyclonal HIV2 gp26 antibody; immunogen full length recombinant p26 (HIV-2 ROD) produced in E.coli expression system</p>Degré de pureté :Min. 95%H-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH
<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Melanocyte Protein PMEL 17 (256-264) (human, bovine, mouse)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C44H67N9O14Masse moléculaire :946.05 g/mol[Arg8]-Vasopressin
CAS :<p>Arginine vasopressin (AVP) is an anti-diuretic peptide. It regulates extracellular fluid volume and electrolyte homeostasis.</p>Formule :C46H65N15O12S2Masse moléculaire :1,084.23 g/mol
![[Arg8]-Vasopressin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50241.webp&w=3840&q=75)
