Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.118 produits)
- Par Biological Target(99.156 produits)
- Par usage/effets pharmacologiques(6.788 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.748 produits)
- Métabolites secondaires(14.233 produits)
130579 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-ILDFGLAR^-OH
<p>Peptide H-ILDFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>4'-Methylchrysoeriol
CAS :<p>4'-Methylchrysoeriol is a ligand that binds to the allosteric site of the nicotinic acetylcholine receptor (nAChR) and activates it. It has been shown to be a potent inhibitor of the nAChR. 4'-Methylchrysoeriol has been used as a research tool to study the effects of channel activation on cell biology and ion channels, as well as for investigating protein interactions.</p>Formule :C17H14O6Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :314.29 g/molAc-RRRRRRRRRRRR-OH
<p>Peptide Ac-RRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGYPITDDLDIYTR^-OH
<p>Peptide H-LGYPITDDLDIYTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEETVQAK^-OH
<p>Peptide H-LEETVQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFSWASVTSK^-OH
<p>Peptide H-TFSWASVTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Follicle Stimulating Hormone (FSH), Recombinant
<p>Please enquire for more information about Follicle Stimulating Hormone (FSH), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :≥95% By Sds-Page.H-AVEIGSFLLGR^-OH
<p>Peptide H-AVEIGSFLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TAALGCLVKDYFPEPVTV-OH
<p>H-TAALGCLVKDYFPEPVTV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TAALGCLVKDYFPEPVTV-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TAALGCLVKDYFPEPVTV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TAALGCLVKDYFPEPVTV-OH at the technical inquiry form on this page</p>Degré de pureté :Min. 95%H-DPK^PIPGNW-OH
<p>Peptide H-DPK^PIPGNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YFDSFGDLSSASAIMGNAK^-OH
<p>Peptide H-YFDSFGDLSSASAIMGNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5TAMRA-LKRYKRRL-OH
<p>Peptide 5TAMRA-LKRYKRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RR^-OH
<p>Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IKGIKGIK^G-OH
<p>Peptide H-IKGIKGIK^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDLIAEVETDK^ATV-OH
<p>Peptide H-GDLIAEVETDK^ATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQRY-NH2
<p>H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C194H295N55O57Masse moléculaire :4,309.81 g/molH-VLELTSDNDR^-OH
<p>Peptide H-VLELTSDNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HLA-A*02:01 Human MAGE-C1 ILFGISLREV
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-GPLTTPVGGGIR^-OH
<p>Peptide H-GPLTTPVGGGIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PVDEALR^-OH
<p>Peptide H-PVDEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFLEAFK^-OH
<p>Peptide H-LFLEAFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>AZD 2098
CAS :<p>A potent and selective agonist of CCR4 chemokine receptor with IC50 values ranging from 10 to 25 nM across different species. CCR4 is involved in activation and migration of Th2 lymphocytes to the lungs in response to allergens. Treating sensitised rats results in reduced inflammation of lung tissue.</p>Formule :C11H9Cl2N3O3SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :334.18 g/molCA 15-3 (Low Cross-reactivity), Part Purified
<p>CA 15-3 (Low Cross-reactivity), Part Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CA 15-3 (Low Cross-reactivity), Part Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>H-EALDESIPPVSFWR^-OH
<p>Peptide H-EALDESIPPVSFWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTVSGTL^^IGLEFIR-OH
<p>Peptide H-GTVSGTL^^IGLEFIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MBP (63-81)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,645.1 g/molH-TPSLPTPPTR^-OH
<p>Peptide H-TPSLPTPPTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-RKRSHAGYQTI-OH
<p>Peptide Ac-RKRSHAGYQTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-R^PKPQQFFGLM-OH
<p>Peptide H-R^PKPQQFFGLM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LPDSNVGVGRHDLGSHRSC-NH2
<p>Ac-LPDSNVGVGRHDLGSHRSC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-LPDSNVGVGRHDLGSHRSC-NH2 is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-LPDSNVGVGRHDLGSHRSC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-LPDSNVGVGRHDLGSHRSC-NH2 at the technical inquiry form on this page</p>Degré de pureté :Min. 95%H-SGRGKGGKGLGKGGAKRHRKV-NTBiot
<p>Peptide H-SGRGKGGKGLGKGGAKRHRKV-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGKGLSATVTGGQK^GRGSR-OH
<p>Peptide H-CGKGLSATVTGGQK^GRGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAVVR^-OH
<p>Peptide H-VAVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Human/Rat/Mouse PLP40-59 peptide, depalmitoylated
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Ac-CSSTIVEDPQTK-NH2
<p>Peptide Ac-CSSTIVEDPQTK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein (TIRAP) (Isoform b)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-SVLLDAASGQLR-OH
<p>H-SVLLDAASGQLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SVLLDAASGQLR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SVLLDAASGQLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SVLLDAASGQLR-OH at the technical inquiry form on this page</p>Degré de pureté :Min. 95%E-64
CAS :<p>Inhibitor of cathepsins and other cysteine proteases</p>Formule :C15H27N5O5Degré de pureté :Min. 98 Area-%Couleur et forme :White PowderMasse moléculaire :357.41 g/molH-GFYAEGSR^-OH
<p>Peptide H-GFYAEGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HEIPVLPNR^-OH
<p>Peptide H-HEIPVLPNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Racecadotril - Bio-X ™
CAS :<p>Racecadotril is an anti-secretory enkephalinase inhibitor that is used in the treatment of diarrhea. This drug works by inhibiting the enzyme enkephalinase. As a result of this, this drug helps to reduce excess fluid and electrolyte loss from the intestines thereby decreasing the severity of diarrhea.</p>Formule :C21H23NO4SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :385.48 g/molR8-BAD amide (rat)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-LGGDLGTYVINK^^-OH
<p>Peptide H-LGGDLGTYVINK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQELGALR-OH
<p>H-GQELGALR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GQELGALR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GQELGALR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GQELGALR-OH at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Casein Kinase II Assay Kit
<p>Peptide Casein Kinase II Assay Kit is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C45H73N19O24Masse moléculaire :1,264.2 g/molH-GQSEVSAAQLQER^-OH
<p>Peptide H-GQSEVSAAQLQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFLQFGAQGSPFLK^-OH
<p>Peptide H-LFLQFGAQGSPFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPSLPTPPTREPK^-OH
<p>Peptide H-TPSLPTPPTREPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALELLMAANFLDC-OH
<p>H-ALELLMAANFLDC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ALELLMAANFLDC-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ALELLMAANFLDC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ALELLMAANFLDC-OH at the technical inquiry form on this page</p>Degré de pureté :Min. 95%
