Produits biochimiques et réactifs

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-CRVSSEPPASIRPKTDDTSS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-RAPGLITPGSPPPAQQNQYV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RAPGLITPGSPPPAQQNQYV-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RAPGLITPGSPPPAQQNQYV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RAPGLITPGSPPPAQQNQYV-OH at the technical inquiry form on this page</p>

<p>Pkg1Alpha is a human active recombinant protein that is intended for research use only. Pkg1Alpha is an activator of the PKG-1alpha protein, which plays a role in cellular signaling pathways. Pkg1Alpha can be used as a research tool to study protein interactions and may be an inhibitor or activator of ion channels and/or ligand-gated ion channels. This protein has been shown to be high in purity, with no detectable contaminants.</p>

<p>H-Orn-Orn-Orn-OH acetate salt is a chemical compound with the molecular formula C10H14O2. It is used as a building block in organic chemistry, often as an intermediate for the synthesis of other compounds, or as a reagent.</p>

<p>H-Leu-Asp-OH is a phenolic compound that is synthesized by the esterification of L-leucine and L-aspartic acid. The solubility of H-Leu-Asp-OH in organic solvents, such as dichloromethane and ethanol, is higher than in water. This product can be used as a solvent for other substances and as a boosting agent for other products during clinical trials. It has been shown to have health effects on humans, but more research is needed to determine any possible side effects or long term health problems.</p>

<p>IL34</p>

<p>Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (251-264) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb.</p>

<p>Histone H3 (1-22) K9Me1-Biotin is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.Another modification process histones can undergo is biotinylation where the covalent attachment of a biotin molecule is catalysed by the enzyme Biotinidase. This cleaves biocytin to generate a biotinyl-thiester intermediate. The biotinyl can then be transferred onto the histone lysine ɛ-amino group which in this case it is covalently attached to Histone 3. Overall the biotinylation sites identified in histone 3 are: K4, K9 and K18. The presence of biotinylated histones have been detected in human cells such as lymphocytes and lymphomas.</p>

<p>Human serum albumin antibody was raised in goat using human albumin as the immunogen.</p>

<p>BTN2A1 antibody was raised using the N terminal of BTN2A1 corresponding to a region with amino acids SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH</p>

<p>Candida Albicans antibody is a growth factor that belongs to the group of Monoclonal Antibodies. It contains histidine and autoantibodies, which are essential for promoting hepatocyte growth and activation. This antibody also interacts with phosphatase and isothiocyanate inhibitors, as well as natriuretic, dopamine, and fibrinogen monoclonal antibodies. Additionally, it has been shown to have steroid properties. With its unique composition, Candida Albicans antibody offers a comprehensive solution for various medical applications.</p>

<p>Haptoglobin protein is a versatile molecule that plays an important role in various biological processes. It is a glycoprotein that binds to free hemoglobin, preventing its oxidative damage and facilitating its clearance from the bloodstream. This protein can be used as a reagent in various research applications, including immunoblotting, ELISA, and immunohistochemistry. Monoclonal antibodies specific to haptoglobin are available for use in these experiments. Additionally, haptoglobin has been shown to have neuroprotective effects and may play a role in modulating inflammation. Its acidic nature allows it to bind to other molecules such as insulin and fibronectin, further expanding its potential applications. Overall, haptoglobin is a valuable tool for researchers studying proteins and antigens and exploring their functions in different biological systems.</p>

<p>JAK3</p>

<p>Metabotropic glutamate receptors (mGluRs) are G protein-coupled receptors that have been divided into three groups based on sequence, putative signal transduction mechanisms, and pharmacologic properties. mGluR1 is a group I receptor. Group I mGluRs are predominantly expressed in the postsynaptic somatodendritic regions, especially in brain areas highly responsive to psychostimulants. mGluR1 is a pivotal regulator of glutamatergic neurotransmission which is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions.</p>

<p>Anti-NDI antibody</p>

<p>H-SSSGNK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SSSGNK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SSSGNK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SSSGNK-OH at the technical inquiry form on this page</p>

<p>Inhibitor of proteaseγ‐secretase, which allows to modulate of the activity of γ‐secretase substrates Notch, E-cadherin, ErbB4, and amyloid precursor protein (APP). The compound can inhibit the growth of tongue carcinoma cells by arresting cell cycle in G0–G1 phase, modulate the activity of Notch1 receptor and Caspase-3 protease and induce apoptosis. It was also demonstrated that this inhibitor reduces the levels of β-amyloid peptide in the brain of mice model for Alzheimer’s disease. This compound also enhances the neuronal differentiation embryonic cells.</p>

<p>MAP3K5</p>

<p>LDL protein is a necrosis factor-related apoptosis-inducing protein that plays a crucial role in various biological processes. It is commonly used in research and diagnostics, particularly in the field of Life Sciences. This native protein can be obtained from nuclear extracts and is available as a monoclonal antibody. LDL protein undergoes glycosylation and glycation, which contribute to its stability and functionality. It can be used in experiments involving electrode assays or endothelial growth studies. Researchers often utilize LDL protein to investigate its interaction with other molecules, such as erythropoietin or growth factors. Moreover, LDL protein has been found to possess antiangiogenic properties, making it an interesting target for therapeutic applications. Its effects on human serum have also been extensively studied, providing valuable insights into its potential impact on human health. In summary, LDL protein is a versatile and essential component in the field of Life Sciences. Its unique characteristics make it an invaluable tool for research and diagnostic purposes.</p>

<p>Highly specific protein tag that can be added to a protein using recombinant DNA technology. FLAG is an artificial antigen to which high affinity monoclonal antibodies have been raised, therefore allowing for highly effective protein purification by affinity chromatography as well as accurate localisation of FLAG tagged proteins within living cells, or Western blots. FLAG peptide can be used to effectively purify complexes with multiple proteins as its mild purification procedure tends not to disrupt such complexes. It can be used to obtain proteins of sufficient purity for x-ray crystallography.</p>

<p>ORF7a is an accessory protein that is key to SARS-CoV-2 evading the immune system. ORF7a acts on the secretory pathway to lower surface MHC-I expression by specifically interacting with the MHC-I heavy chain and delaying its export from the endoplasmic reticulum. These factors make the ORF6 protein a viable target for developing new antiviral drugs. In addition, the identification of epitopes within the ORF7a-10 protein sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. ORF7a-10 protein (69-86) is an epitope candidate with various predicted HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.</p>

<p>Aniracetam is a nootropic drug that is used to alleviate memory disturbances caused by cerebrovascular disease and brain disorders. This drug has anti-depressive and anxiolytic properties and is said to target serotonin and dopamine receptors.</p>

<p>Trail human is a protein that is encoded by the TRAIL gene. Trail human binds to death receptor 4 (DR4) and DR5 and mediates apoptosis. It has been shown to be expressed in leukemia cells, where it may be involved in the regulation of genes involved in apoptosis. Trail human also has an anti-tumorigenic effect on brain tumors, as it inhibits tumor growth without affecting normal tissue. Trail human has been shown to inhibit cancer cell proliferation by blocking the synthesis of proteins required for DNA replication and cell division. Trail human also induces apoptosis through activation of caspase 3 and 9 by binding to their respective receptors DR4 and DR5.</p>

<p>H-Arg-AMC hydrochloride is a denaturing agent that is used to prevent the proteolytic degradation of proteins in muscle and other tissues. It has been shown to inhibit the activity of lipase, myofibrillar, and endoplasmic enzymes. H-Arg-AMC hydrochloride also has cancer preventive effects by inhibiting the growth of tumor cells. H-Arg-AMC hydrochloride has been shown to have high values in notochord markers, supplementing cytosolic markers, and endogenous markers.</p>

<p>Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.</p>

<p>Peptide H-EEDFPSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Desmoglein-3 DSG3 (50-79) is derived from the pemphigus vulgaris antigen DSG3 and is involved in cell-cell adhesion. It can exist as non-junctional and junctional and is one of the desmosomal cadherins. Within the epithelial cells non-junctional DSG3 takes part in E-cadherin signalling.The overexpression of DSG3 has been observed in squamous cell carcinoma and can be used as a biomarker for cervical sentinel lymph nodes. DSG3 in tumours is considered as being pro-metastatic through DSG3 ability to activate AP-1 and the PKC/Ezrin pathway.Biotin (B7) has been added to the N-terminus.</p>

<p>Inhibitor of PDE4 enzyme</p>

<p>The α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) is an ionotropic transmembrane receptor for glutamate found throughout the central nervous system (CNS). AMPARs are composed of four types of subunits: GluR1/GluA1, GluR2/GluA2, GluR3/GluA3, and GluA4 (GluRA-D2), which combine to form heterotetramers.</p>

<p>Angiotensin-converting enzyme 2 (ACE2) is a receptor present in the human cardiovascular system as well as in the gut, kidneys, central nervous system, and adipose tissue. ACE2 is a negative regulator of the renin angiotensin system (RAS) mainly by converting Ang (angiotensin) I and Ang II into Ang 1-9 and Ang 1-7, respectively.</p>

<p>Delparantag is a heparin-mimetic that is used to treat inflammatory diseases and thrombocytopenia. It has been shown to be effective in vivo and in vitro models of heparin-induced thrombocytopenia. Delparantag inhibits the activation of platelets by binding to the platelet factor 4 (PF4) receptor, which prevents the binding of PF4 to its receptor on the surface of platelets. This results in a reduction in aggregation and clot formation, as well as inhibiting inflammation. Delparantag has also been shown to be effective for treating bowel disease by reducing inflammation, with clinical studies showing that it reduced bowel movements from 12 per day to four per day.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-CGGDLPPASSEARNSAF-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGDLPPASSEARNSAF-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGDLPPASSEARNSAF-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGDLPPASSEARNSAF-NH2 at the technical inquiry form on this page</p>

<p>Aloe-emodin is an anthraquinone derivative that is found in the aloe plant. It has a strong stimulant laxative action. Aloe-emodin may be useful in the treatment of cancer, as it inhibits cell proliferation by inducing apoptosis.</p>

<p>This C-terminal Sortagging peptide acts as a (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye.  This method of protein labelling is known as sortagging.This peptide contains Sulfocyanine5, which is a fluorescent red dye.</p>

<p>Inhibitor of tyrosinase in melanocytes: skin whitener</p>

<p>Anti-CYR61 antibody</p>

<p>Purified Polyclonal ADRB2 antibody</p>

<p>Anti-Mrgpre antibody</p>

<p>The PAPPA protein is a key player in various biological processes. It is involved in the regulation of TGF-beta and fibronectin, making it crucial for tissue development and repair. Our monoclonal antibody specifically targets the PAPPA protein, allowing for precise detection and analysis. This specific antibody has been extensively validated in Life Sciences research and is widely used in studies involving EGF-like growth factors. Additionally, our neutralizing antibody has shown promising results in blocking the activity of PAPPA, making it a valuable tool for investigating its role in various diseases. Whether you are studying autoantibodies, chemokines, or other growth factors, our Native Proteins &amp; Antigens collection offers high-quality reagents to support your research needs.</p>

<p>H-LRTSLAALEQRSFGL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LRTSLAALEQRSFGL-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LRTSLAALEQRSFGL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LRTSLAALEQRSFGL-OH at the technical inquiry form on this page</p>

<p>Feline Infectious Peritonitis Virus (FIPV) Antigen is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Feline Infectious Peritonitis Virus (FIPV) Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Antibody which recognises human histone H2B. H2B is one of the four core histone proteins which make up the protein core of the nucleosome around which DNA is wound to form the basic unit of chromatin. H2B, like other histone proteins is highly conserved across species with even distantly related species having high levels of sequence homology. Post translational modifications of histones such as H2B by acetylation, phosphorylation and ubiquitination can affect the organisation of the chromatin and gene transcription. There are 16 isoforms of H2B in humans, 13 that are expressed in somatic cells, and 3 that are testis-specific.</p>

<p>T regulatory cell epitopes (Tregitopes) are a set of natural T cell epitopes derived from immunoglobulin G. These peptides are Treg-activating and show some promise in prophylactic and therapeutic studies in type 1 diabetes mellitus: which is associated with effector T cell (Teff) destruction of insulin-producing pancreatic β-islet cells. In non-diabetics, self-reactive T cells are deleted during thymic development, rendered anergic, or converted into natural regulatory T cells (Tregs) that suppress autoimmune responses.Tregitopes are processed and presented by MHC class II molecules. They can suppress effector T cell responses, and up-regulate Treg-associated cytokines and chemokines. Tregitopes help stimulate 'antigen-specific adaptive tolerance induction' (ASATI) to modulate antigen-specific transplant rejection and to reduce immune responses to allergens in vitro and in vivo.</p>

<p>Anti-SCN9A/Nav1.7 antibody</p>

<p>Melittin is a 26-residue cationic, haemolytic peptide isolated from honeybee venom. Melittin lowers the surface tension at the plasma membrane and causes cell lysis. It also exhibits potent anti-inflammatory and antimicrobial activity. Melittin has been extensively used as a model peptide for observing membrane lipid-protein interaction. In Melittin [Cy5] the fluorophore Cy5, a member of the Cy-Dye fluorescent molecule group which are most commonly used in DNA-related applications is added to the melittin peptide.</p>

<p>Peptide Ac-ADE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Lactoferrin antibody was raised in mouse using lactoferrin from human milk as the immunogen.</p>

<p>The ApoE antibody is a powerful tool used in the field of Life Sciences. It belongs to the category of anti-CD20 antibodies and is primarily used for research purposes. This hormone peptide antibody is designed to specifically target and bind to the CD20 protein, which is expressed on the surface of certain cells such as B lymphocytes.</p>