Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Lire la suite
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
Produits appartenant à la catégorie "Produits biochimiques et réactifs"
H-K^CNTA^TCATQRLANFLVHSSNNFGAILSSTNVG^SNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please …
Ref: 3D-PH00273
| Taille indéfinie | À demander |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
H-IVGGWECEK^-OH
Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00270
| Taille indéfinie | À demander |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
H-ISIDVNNNDIK^-OH
Peptide H-ISIDVNNNDIK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00267
| Taille indéfinie | À demander |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
H-IPNAGQMQPVK^-OH
Peptide H-IPNAGQMQPVK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00264
| Taille indéfinie | À demander |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
H-IGSEAYNQQLSEK^-OH
Peptide H-IGSEAYNQQLSEK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00254
| Taille indéfinie | À demander |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
H-IGGHGAEYGAEALER^-OH
Peptide H-IGGHGAEYGAEALER^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00252
| Taille indéfinie | À demander |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
H-IDIDIER^-OH
H-IDIDIER-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please …
Ref: 3D-PH00249
| Taille indéfinie | À demander |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
H-IDEALER^-OH
Peptide H-IDEALER^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PH00246
| Taille indéfinie | À demander |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
![[Glu1]-Fibrinopeptide B](https://static.cymitquimica.com/products/3D/thumb/PFB-3742-PI.jpg)
[Glu1]-Fibrinopeptide B
Fibrinopeptide B is a peptidic, biologically active peptide with the sequence Glu-Lys-Arg-Val. It is an …
Formule :
C66H95N19O26
Degré de pureté :
Min. 95%
Masse moléculaire :
1,570.6 g/mol
Ref: 3D-PFB-3742-PI
| 1mg | 257,00 € | ||
| 5mg | 814,00 € |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
CART (Rat, 55-102)
CAS :209615-79-2
CART (Rat, 55-102) is an antibody that binds to the CART receptor. It can be …
Formule :
C226H367N65O65S7
Degré de pureté :
Min. 95%
Masse moléculaire :
5,259.2 g/mol
Ref: 3D-PCA-4351-S
| 100µg | 635,00 € |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
CART (Human, 55-102)
CAS :214050-22-3
CART is a peptide that acts as an activator for the CART receptor. It has …
Formule :
C225H365N65O65S7
Degré de pureté :
Min. 95%
Masse moléculaire :
5,245.2 g/mol
Ref: 3D-PCA-4350-S
| 100µg | 635,00 € |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
Plasmodium falciparum antibody
Plasmodium falciparum antibody was raised in mouse using histadine rich protein II from Plasmodium falciparum …
Ref: 3D-10-P09B
| 1mg | 732,00 € |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
Cyclo(Arg-Ala-Asp-D-Phe-Val)
CAS :137813-36-6
Cyclo(Arg-Ala-Asp-D-Phe-Val) is an active, cyclic peptide that has been shown to have localized effects on …
Formule :
C27H40N8O7
Degré de pureté :
Min. 95%
Masse moléculaire :
588.68 g/mol
Ref: 3D-PCA-3618-PI
| 1mg | 136,00 € | ||
| 5mg | 315,00 € | ||
| 25mg | 998,00 € |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
Cy5-TFSDLWKLL-OH
Peptide Cy5-TFSDLWKLL-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PC00002
| Taille indéfinie | À demander |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
Candida albicans protein
Candida albicans protein is a native protein that plays a crucial role in the immune …
Degré de pureté :
Partially Purified
Ref: 3D-30-AC01
| 1mg | 663,00 € |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
Cbz-D-Arg-Gly-Arg-pNA
Peptide Cbz-D-Arg-Gly-Arg-pNA is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PC00001
| Taille indéfinie | À demander |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
β-Ala-Lys(AMCA)
CAS :180342-52-3
β-Ala-Lys(AMCA) is a peptide that can inhibit the interactions of proteins. β-Ala-Lys(AMCA) is an inhibitor …
Formule :
C21H28N4O6
Degré de pureté :
Min. 95%
Masse moléculaire :
432.47 g/mol
Ref: 3D-PBP-3412-V
| 5mg | 370,00 € |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
BNP-45 (Rat)
CAS :123337-89-3
BNP-45 is a peptide that binds to the beta-subunit of the Na+/K+ ATPase, inhibiting its …
Formule :
C213H349N71O65S3
Degré de pureté :
Min. 95%
Masse moléculaire :
5,040.7 g/mol
Ref: 3D-PBN-4218-S
| 100µg | 338,00 € |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
BNP-32 (Human)
CAS :124584-08-3
BNP-32 is a peptide that has been shown to activate G-protein coupled receptors and ion …
Formule :
C143H244N50O42S4
Degré de pureté :
Min. 95%
Masse moléculaire :
3,464.05 g/mol
Ref: 3D-PBN-4212-V
| 500µg | 863,00 € |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
CRP protein (>95% pure) (Azide free)
Purified native Human C-reactive protein with no preservative added
Degré de pureté :
>95% By Sds-Page
Ref: 3D-30-AC05AF
| 5mg | 350,00 € |
Livraison estimée en/au États-Unis, le vendredi 13 décembre 2024
