
Acides carboxyliques
12457 produits trouvés pour "Acides carboxyliques"
GLP-2 (1-34) (human) trifluoroacetate salt
CAS :Structure/Function: human; Trifluoroacetate saltFormule :C171H266N48O56SDegré de pureté :Min. 95%Masse moléculaire :3,922.3 g/molMet(O)14-Exenatide trifluoroacetate salt
CAS :Please enquire for more information about Met(O)14-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C184H282N50O61SDegré de pureté :Min. 95%Masse moléculaire :4,202.57 g/molmeso-Tartaric acid monohydrate
CAS :Meso-tartaric acid monohydrate is a white crystalline substance that is soluble in water and has a strong acidic taste. It is an organic acid, which can be found in many fruits and vegetables. Meso-tartaric acid monohydrate is used as the sodium salt or potassium salt, which may lead to drug interactions with other drugs that are excreted through the kidneys. The product also inhibits the enzyme DPP-IV, which is involved in the degradation of glucagon and insulin. In addition, meso-tartaric acid monohydrate can cause an increase in surfactant sodium dodecyl sulfate (SDS) activity when it interacts with trifluoroacetic acid (TFA). Meso-tartaric acid monohydrate also prevents the growth of coli k-12 by inhibiting protein synthesis. This product has been shown to inhibit dpp-iv inhibitors from forming hydrogen bonds with malonic acid and polymorphon
Formule :C4H6O6·H2ODegré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :168.1 g/molPep-1-cysteamide trifluoroacetate salt
CAS :Please enquire for more information about Pep-1-cysteamide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C140H202N36O33SDegré de pureté :Min. 95%Masse moléculaire :2,949.39 g/molOsteoblast Activating Peptide (human) trifluoroacetate salt
Please enquire for more information about Osteoblast Activating Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C120H196N38O37SDegré de pureté :Min. 95%Masse moléculaire :2,795.14 g/mol(D-Trp8)-gamma2-MSH trifluoroacetate salt
CAS :Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C74H99N21O16SDegré de pureté :Min. 95%Masse moléculaire :1,570.78 g/mol(Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
Please enquire for more information about (Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C130H203N37O30SDegré de pureté :Min. 95%Masse moléculaire :2,796.3 g/molEthyl 4-methoxyphenylacetate
CAS :Ethyl 4-methoxyphenylacetate is a fatty acid that is synthesized by the condensation of aniline and pyrrole. It has been shown to inhibit the growth of bacteria, such as Salmonella typhi and Staphylococcus aureus, in vitro. The inhibition of bacterial growth is thought to be due to its ability to react with hydrogen fluoride, which results in the formation of reactive oxygen species and nitrogen radicals. This compound also inhibits the production of tyrosinase in human skin cells, which may be beneficial for individuals with acne. Ethyl 4-methoxyphenylacetate has been shown to be safe for use in clinical trials.Formule :C11H14O3Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :194.23 g/molBradykinin (2-7) acetate salt
CAS :Please enquire for more information about Bradykinin (2-7) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C29H40N6O8Degré de pureté :Min. 95%Masse moléculaire :600.66 g/molH-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt
CAS :Please enquire for more information about H-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C29H42N8O4SDegré de pureté :Min. 95%Masse moléculaire :598.76 g/molProtein Kinase P34 (cd2) Substrate trifluoroacetate salt
CAS :H-ADAQHATPPKKKRKVEDPKDF-OH peptide, which can act as a substrate of Protein Kinase P34 (cd2). The peptide is supplied as a trifluoroacetate salt.Formule :C106H172N32O32Degré de pureté :Min. 95%Masse moléculaire :2,406.7 g/mol3,4,9,10-Perylenetetracarboxylic diimide
CAS :3,4,9,10-Perylenetetracarboxylic diimide is a model system for studying the mechanism of protonated pyridine. It is a bicyclic heterocycle that contains two phenyl rings and one imide group. The nitrogen atoms in the molecule form hydrogen bonds with other molecules and can be substituted with chlorine or bromine. 3,4,9,10-Perylenetetracarboxylic diimide has been shown to have chemical stability under conditions of hydrochloric acid and heat. This compound also has a high melting point and is not soluble in water. 3,4,9,10-Perylenetetracarboxylic diimide has been used to study the reaction mechanisms of chemical reactions involving light emission. This compound absorbs light at wavelengths longer than 400 nm (e.g., ultraviolet) and emits light at wavelengths shorter than 400 nm (e.g.,
Formule :C24H10N2O4Couleur et forme :PowderMasse moléculaire :390.35 g/molH-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt
CAS :Please enquire for more information about H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C28H49N7O11Degré de pureté :Min. 95%Masse moléculaire :659.73 g/mol(Des-Thr5)-Glucagon trifluoroacetate salt
CAS :Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C149H218N42O47SDegré de pureté :Min. 95%Masse moléculaire :3,381.65 g/molHexanedioic acid
CAS :Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.Formule :C6H10O4Couleur et forme :White Off-White PowderMasse moléculaire :146.14 g/molBeclomethasone 21-acetate 17-propionate
CAS :Produit contrôléPlease enquire for more information about Beclomethasone 21-acetate 17-propionate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C27H35ClO7Degré de pureté :Min. 95%Masse moléculaire :507.02 g/mol(D-Phe2·6,Pro3)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about (D-Phe2·6,Pro3)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C59H80N14O13Degré de pureté :Min. 95%Masse moléculaire :1,193.35 g/molGalanin (2-11) amide trifluoroacetate salt
CAS :Galanin (2-11) amide trifluoroacetate salt H-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu is a galanin analog and a ligand for the galanin receptor 1. It has affinity for the receptors in the brain, which are involved in cognition, and is used to study Alzheimer's disease. Galanin (2-11) amide trifluoroacetate salt H-Trp-Thr-Leu-Asn-Ser -Ala -Gly -Tyr -Leu -Leu is a member of the family of neuropeptides and neuromodulators that regulate nerve injury and alzheimer's disease.Formule :C54H81N13O14Degré de pureté :Min. 95%Masse moléculaire :1,136.3 g/mol2-Chlorooxazole-4-carboxylicacid
CAS :2-Chlorooxazole-4-carboxylic acid is a synthetic compound belonging to the group of long-chain aliphatic carboxylic acids. It is an ester that can be synthesized by the reaction of toluene with 2,4-dichlorooxazole. The stereochemical configuration of this molecule is unknown. The synthesis of this compound has been reported in marine invertebrates and plants, including Mycalolide from the marine sponge Mycale sp.Formule :C4H2ClNO3Degré de pureté :Min. 95%Masse moléculaire :147.52 g/molDibenzoyl-(-)-p-methoxy-L-tartaric acid
CAS :Dibenzoyl-(-)-p-methoxy-L-tartaric acid is a chiral compound that has been extracted from plants and synthesized. It has a bitter taste and can be used as an enantiomer to treat schistosomiasis, a disease caused by parasitic flatworms. Dibenzoyl-(-)-p-methoxy-L-tartaric acid can be used as an enantiomer to treat schistosomiasis, which is caused by parasitic flatworms. The chemical is an anionic β-cyclodextrin derivative that binds to the parasites in the host's body and prevents them from releasing eggs into the water supply. This chemical also has pharmacological properties, such as antiinflammatory activities.
Formule :C20H18O10Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :418.35 g/mol4-Hydroxyphenyl acetate
CAS :4-Hydroxyphenyl acetate is a naturally occurring fatty acid that is found in many plants. It has been isolated from the seeds of Telfairia occidentalis and has been shown to inhibit the growth of bacteria at a pH of 7.5, with an optimal pH of 8.0. 4-Hydroxyphenyl acetate is an activated form of this compound, which means it contains two hydroxyl groups and does not have to be synthesized by enzymes. 4-Hydroxyphenyl acetate inhibits bacterial enzyme activities such as DNA gyrase and RNA polymerase, which are necessary for transcription and replication. The structure analysis of 4-hydroxy phenylacetate was determined using trifluoroacetic acid (TFA) on a wild-type strain of Escherichia coli K12.
Formule :C8H8O3Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :152.15 g/mol2-Amino-5-chloro-3-methylbenzoic acid
CAS :2-Amino-5-chloro-3-methylbenzoic acid (ACMB) is a substructure of the insecticidal compound chlorantraniliprole. It is a solid at room temperature and has a molecular weight of 142.15 g/mol. ACMB can be extracted from n-hexane, chlorantraniliprole, or xylene using gravimetric analysis. The bioactivity of ACMB can be determined by an anthranilic assay, while its solubility data are available in the literature. ACMB has been shown to have insecticidal activity against lepidoptera larvae and cyanuric activity against mosquito larvae.Formule :C8H8ClNO2Degré de pureté :Min. 95%Masse moléculaire :185.61 g/molH-Arg-Phe-OH acetate salt
CAS :H-Arg-Phe-OH Acetate Salt is a peptide that has the amino acids H, Arg, Phe and OH. It is a stable complex with amines and is effective in reducing blood pressure. The binding constants are high, which means that it can be used as an antihypertensive agent. A study on the haemodynamic effects of H-Arg-Phe-OH Acetate Salt showed that it could inhibit the release of noradrenaline levels in the body. The reaction mechanism for H-Arg-Phe-OH Acetate Salt is functional groups plus fatty acids; kidney bean is one of its sources.
Formule :C15H23N5O3Degré de pureté :Min. 95%Masse moléculaire :321.38 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS :Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C50H77N9O12SDegré de pureté :Min. 95%Masse moléculaire :1,028.27 g/molCortistatin-17 (human) trifluoroacetate salt
CAS :Please enquire for more information about Cortistatin-17 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C96H139N27O24S3Degré de pureté :Min. 95%Masse moléculaire :2,151.5 g/molAtrial Natriuretic Factor (5-27) (human) trifluoroacetate salt
CAS :Please enquire for more information about Atrial Natriuretic Factor (5-27) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C97H154N34O32S3Degré de pureté :Min. 95%Masse moléculaire :2,404.67 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS :H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.Formule :C36H74N24O7Degré de pureté :Min. 95%Masse moléculaire :955.13 g/molAc-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt
CAS :Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.Formule :C23H34N6O9Degré de pureté :Min. 95%Masse moléculaire :538.55 g/molGRF (human) acetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H358N72O66SDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :5,039.65 g/molH-Lys-Lys-Lys-Lys-OH acetate salt
CAS :H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both ofFormule :C24H50N8O5Degré de pureté :Min. 95%Masse moléculaire :530.7 g/molEndothelin-3 (human, mouse, rabbit, rat) trifluoroacetate salt
CAS :Trifluoroacetate saltFormule :C121H168N26O33S4Degré de pureté :Min. 95%Masse moléculaire :2,643.05 g/molAngiotensin II acetate salt
CAS :Produit contrôléAngiotensin II is a hormone that is produced in the kidneys and acts on the blood vessels, heart, and other tissues. It is also known as angiotensin II acetate salt H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH acetate salt. Angiotensin II can increase blood pressure by constricting blood vessels and causing the release of aldosterone from the adrenal glands. This hormone also causes smooth muscle contraction in various organs, including the intestines. The synthesis of angiotensin II occurs through two different pathways: one involving renin and another involving prorenin. The renin pathway begins with renin converting angiotensinogen into angiotensin I, which is then converted to angiotensin II by angiotensins I converting enzyme (ACE). Angiotensin II has been shown to increase protein phosphorylation in myosin, leading to increasedFormule :C50H71N13O12·xC2H4O2Degré de pureté :Min. 95%Couleur et forme :White SolidMasse moléculaire :1,046.18 g/molAc-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt
CAS :Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt is a basic protein. It inhibits the neuronal death induced by dopamine and its derivatives, which is caused by overactivation of the mitochondrial membrane potential and release of cytochrome c from mitochondria to cytosol. This compound also inhibits the activation of toll-like receptor 4 (TLR4) and nuclear factor κB (NF-κB) signaling pathways in neuronal cells. Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt has been shown to have antiinflammatory effects when applied topically on skin wounds. The molecule has been used as a model system for studying the molecular mechanism of epidermal growth factor (EGF) activation in hybridoma cell lines and primary cells.Formule :C21H31ClN4O11Degré de pureté :Min. 95%Masse moléculaire :550.94 g/mol2,4,5-Trifluorobenzoic acid
CAS :2,4,5-Trifluorobenzoic acid is a synthetic compound that is used as an organic solvent. It has been detected in the environment at low concentrations, but can be detected by gas chromatography. 2,4,5-Trifluorobenzoic acid is also used in the synthesis of fluoroquinolones and other pharmaceuticals. The detection time for 2,4,5-trifluorobenzoic acid is about one day. This compound can be decarboxylated to produce benzoic acid and hydrogen fluoride (HF). 2,4,5-Trifluorobenzoic acid decomposes to form chlorine gas when heated with hydrochloric acid or sodium hypochlorite. This substance reacts with copper oxide and forms copper trifluoride. Analytical methods for this compound include ionisation mass spectrometry and expressed gas analysis.
Formule :C7H3F3O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :176.09 g/molBiotinyl-Neuromedin S (human) trifluoroacetate salt
CAS :Please enquire for more information about Biotinyl-Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C183H279N55O46SDegré de pureté :Min. 95%Masse moléculaire :4,017.58 g/mol(Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C194H297N55O56SDegré de pureté :Min. 95%Masse moléculaire :4,327.84 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS :PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.
Formule :C33H46N8O7Degré de pureté :Min. 95%Masse moléculaire :666.77 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond)
CAS :Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C54H66Cl2N12O8S2Degré de pureté :Min. 95%Masse moléculaire :1,146.22 g/mol(R)-(-)-3-Amino-3-phenylpropionic acid
CAS :(R)-(-)-3-Amino-3-phenylpropionic acid is a hydrogenated, stereoselective β-amino acid that is involved in the biosynthesis of animal health. The enzyme acylase catalyzes this reaction by binding with chiral pyridoxal phosphate to form an acylation product. The stereospecificity of the reaction is determined by whether the enzyme has a preference for L or D amino acids. Acylases are found in organisms such as mammals and bacteria.Formule :C9H11NO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :165.19 g/mol12-(Boc-aminooxy)-dodecanoic acid
CAS :Please enquire for more information about 12-(Boc-aminooxy)-dodecanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C17H33NO5Degré de pureté :Min. 95%Masse moléculaire :331.45 g/molAcetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS :Please enquire for more information about Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C150H246N44O38Degré de pureté :Min. 95%Masse moléculaire :3,273.83 g/molAc-Lys-D-Ala-D-lactic acid·acetate
CAS :Produit contrôléPlease enquire for more information about Ac-Lys-D-Ala-D-lactic acid·acetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H25N3O6·C2H4O2Degré de pureté :Min. 95%Masse moléculaire :391.42 g/molAc-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond)
CAS :Please enquire for more information about Ac-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C49H82N16O11S3Degré de pureté :Min. 95%Masse moléculaire :1,167.47 g/molPseudin-2 trifluoroacetate salt
CAS :Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C122H202N36O32Degré de pureté :Min. 95%Masse moléculaire :2,685.13 g/molBenzyl acetate
CAS :Benzyl acetate is a colorless liquid that has a pleasant odor. It is used as a flavoring agent in food, beverages and tobacco products. Benzyl acetate is also used as an intermediate in the production of other chemicals. A low-dose group of rats was given benzyl acetate at doses of 0.5, 1, 5 and 10 mg/kg/day for 30 days. The animals were observed for changes in enzyme activities and thermal expansion reactions. Chronic exposure to benzyl acetate may cause carcinogenesis by inducing dimethyl fumarate (DMF) or methyl transferase activity.Formule :C9H10O2Degré de pureté :Min. 95%Couleur et forme :Colorless Clear LiquidMasse moléculaire :150.17 g/molPAR-2 (6-1) amide (human) trifluoroacetate salt
CAS :Please enquire for more information about PAR-2 (6-1) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C28H54N8O7Degré de pureté :Min. 95%Masse moléculaire :614.78 g/molH-Ile-Arg-OH acetate salt
CAS :H-Ile-Arg-OH acetate salt is an antioxidant that belongs to the group of amino acids. It has been shown to have antioxidative activity in vitro, as well as interaction with radicals and free radicals. Cryo-electron microscopy was used to show this compound's radical scavenging activity. H-Ile-Arg-OH acetate salt has also been found to have antioxidative properties in eukaryotes. This compound is composed of two isomers: H-Ile and Arg. The hydroxyl group on the H-Ile isomer gives this compound its antioxidative properties, while the Arg isomer possesses hydrolytic properties. The subunits are linked together by a peptide bond between the carboxyl group on Arg and the amine group on H-Ile. In addition, H-Ile has an -OH hydroxyl group that can be scavenged by hydroxyl radicals, which provides antioxidative activity.
Formule :C12H25N5O3Degré de pureté :Min. 95%Masse moléculaire :287.36 g/molH-Pro-Phe-Lys-OH acetate salt
CAS :Please enquire for more information about H-Pro-Phe-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C20H30N4O4Degré de pureté :Min. 95%Masse moléculaire :390.48 g/mol4-(4-Phenylbutoxy)benzoic acid
CAS :4-(4-Phenylbutoxy)benzoic acid is an organic compound that is produced by the reaction of 4-hydroxybenzoic acid with a Grignard reagent. The 4-hydroxybenzoic acid reacts with magnesium to form magnesium chloride and p-hydroxybenzoic acid, which then reacts with a Grignard reagent to form the desired product. This compound has been used in wastewater treatment and as an intermediate in the synthesis of dyes, perfumes, and pharmaceuticals. 4-(4-Phenylbutoxy)benzoic acid has also been used as a starting material for synthesizing other compounds such as chlorobenzene and p-hydroxybenzoic acid.
Formule :C17H18O3Degré de pureté :Min. 95%Masse moléculaire :270.32 g/mol2,3,4,5-Tetrafluorobenzoic acid
CAS :Tetrafluorobenzoic acid is a synthetic chemical that is used in the synthesis of antimicrobial agents. Tetrafluorobenzoic acid has been shown to bind to the hydroxyl group of 2,3,4,5-tetrafluorobenzoyl chloride and form a covalent bond. The reaction solution was analyzed using crystallography and showed that there are no intermolecular hydrogen bonds between tetrafluorobenzoic acid molecules. The crystal structure was determined by X-ray diffraction analysis and found that the intramolecular hydrogen bonding may be responsible for the anti-microbial activity of this substance.
Formule :C7H2F4O2Masse moléculaire :194.08 g/mol
