Acides carboxyliques
Les acides carboxyliques sont des molécules organiques caractérisées par un groupe fonctionnel de type carboxyle (-COOH). Ces acides sont fondamentaux dans diverses réactions chimiques, y compris l'estérification, l'amidation et la décarboxylation. Les acides carboxyliques sont largement utilisés dans la production de produits pharmaceutiques, de polymères et d'agrochimiques. Dans cette section, vous pouvez trouver un grand nombre d'acides carboxyliques prêts à l'emploi. Chez CymitQuimica, nous fournissons une large gamme d'acides carboxyliques de haute qualité pour soutenir vos applications de recherche et industrielles.
12457 produits trouvés pour "Acides carboxyliques"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
CART (61-102) (human, rat) trifluoroacetate salt
CAS :Please enquire for more information about CART (61-102) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C189H310N58O56S7Degré de pureté :Min. 95%Masse moléculaire :4,515.3 g/molGRF (human) acetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H358N72O66SDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :5,039.65 g/molH-Val-Ala-pNA acetate salt
CAS :Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C14H20N4O4Degré de pureté :Min. 95%Masse moléculaire :308.33 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS :Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C24H29NO7SDegré de pureté :Min. 95%Masse moléculaire :475.56 g/molRetrocyclin-1 trifluoroacetate salt
CAS :Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.Formule :C74H128N30O18S6Degré de pureté :Min. 95%Masse moléculaire :1,918.4 g/mol(D-Trp6)-LHRH (2-10) trifluoroacetate salt
CAS :Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C59H77N17O11Degré de pureté :Min. 95%Masse moléculaire :1,200.35 g/molAlpha-Casein (90-96) trifluoroacetate salt
CAS :Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C43H64N10O12Degré de pureté :Min. 95%Masse moléculaire :913.03 g/molH-Lys-Lys-Lys-Lys-OH acetate salt
CAS :H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both ofFormule :C24H50N8O5Degré de pureté :Min. 95%Masse moléculaire :530.7 g/molMca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt
CAS :Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C68H88N14O27Degré de pureté :Min. 95%Masse moléculaire :1,533.5 g/molEndothelin-3 (human, mouse, rabbit, rat) trifluoroacetate salt
CAS :Trifluoroacetate saltFormule :C121H168N26O33S4Degré de pureté :Min. 95%Masse moléculaire :2,643.05 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-Lys-OH acetate salt
CAS :Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.Formule :C29H51N11O11Degré de pureté :Min. 95%Masse moléculaire :729.78 g/molWRW4
CAS :Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C61H65N15O6Degré de pureté :Min. 95%Masse moléculaire :1,104.27 g/molAngiotensin II acetate salt
CAS :Produit contrôléAngiotensin II is a hormone that is produced in the kidneys and acts on the blood vessels, heart, and other tissues. It is also known as angiotensin II acetate salt H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH acetate salt. Angiotensin II can increase blood pressure by constricting blood vessels and causing the release of aldosterone from the adrenal glands. This hormone also causes smooth muscle contraction in various organs, including the intestines. The synthesis of angiotensin II occurs through two different pathways: one involving renin and another involving prorenin. The renin pathway begins with renin converting angiotensinogen into angiotensin I, which is then converted to angiotensin II by angiotensins I converting enzyme (ACE). Angiotensin II has been shown to increase protein phosphorylation in myosin, leading to increasedFormule :C50H71N13O12·xC2H4O2Degré de pureté :Min. 95%Couleur et forme :White SolidMasse moléculaire :1,046.18 g/molExtracellular Death Factor trifluoroacetate salt
CAS :Extracellular Death Factor is a molecule that binds to calmodulin, which is a protein found in all animal cells. Extracellular Death Factor can be used to induce apoptotic cell death in any type of cell, including cancer cells. The molecule is composed of three amino acids: H-Asn-Asn-Trp-Asn-Asn-OH. This compound has been shown to inhibit the replication of DNA and RNA in gram negative bacteria and tuberculosis cells. It also has an effect on the structural analysis of the molecule and causes light emission when exposed to ultraviolet light.Formule :C27H36N10O10Degré de pureté :Min. 95%Masse moléculaire :660.64 g/molFormyl-LHRH (2-10) trifluoroacetate salt
CAS :Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C51H70N16O12Degré de pureté :Min. 95%Masse moléculaire :1,099.2 g/mol(Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :Produit contrôléPlease enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C194H296N54O57SDegré de pureté :Min. 95%Masse moléculaire :4,328.82 g/molMet-Enkephalin-Arg acetate salt
CAS :Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C33H47N9O8SDegré de pureté :Min. 95%Masse moléculaire :729.85 g/mol2,5-Anhydro-3,4-dideoxy-erythro-hexaric acid - 98%
CAS :The synthesis of 2,5-anhydro-3,4-dideoxy-erythro-hexaric acid (2,5AHDHE) is described in detail. The reaction starts with the condensation of 3,4-dideoxy-erythro-hexose with aldehyde and furfural to give the hemiacetal. The ring opening of this hemiacetal leads to the formation of 2,5AHDHE and furfural. The protonation of 2,5AHDHE leads to proton release and bond cleavage. Furfural is reduced to 5-hydroxymethylfurfural (HMF). HMF is then oxidized to hydroxyl group by H2O2. The hydroxyl group reacts with a second molecule of 2,5AHDHE to form a new molecule of 2,5AHDHE and H2O2. This process can be repeated untilFormule :C6H8O5Degré de pureté :Min. 98 Area-%Couleur et forme :White PowderMasse moléculaire :160.12 g/molAc-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt
CAS :Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt is a basic protein. It inhibits the neuronal death induced by dopamine and its derivatives, which is caused by overactivation of the mitochondrial membrane potential and release of cytochrome c from mitochondria to cytosol. This compound also inhibits the activation of toll-like receptor 4 (TLR4) and nuclear factor κB (NF-κB) signaling pathways in neuronal cells. Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt has been shown to have antiinflammatory effects when applied topically on skin wounds. The molecule has been used as a model system for studying the molecular mechanism of epidermal growth factor (EGF) activation in hybridoma cell lines and primary cells.Formule :C21H31ClN4O11Degré de pureté :Min. 95%Masse moléculaire :550.94 g/mol([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt
CAS :Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Nociceptin (1-13) amide trifluoroacetate salt
CAS :Please enquire for more information about Nociceptin (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C61H100N22O15Degré de pureté :Min. 95%Masse moléculaire :1,381.59 g/mol4-Difluoromethoxyphenylboronic acid pinacol ester
CAS :Please enquire for more information about 4-Difluoromethoxyphenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C13H17BF2O3Degré de pureté :Min. 95%Masse moléculaire :270.08 g/molGalanin-Like Peptide (human) trifluoroacetate salt
CAS :Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C292H451N83O84SDegré de pureté :Min. 95%Masse moléculaire :6,500.28 g/molDodecylbenzenesulfonic acid, 70% in isopropanol
CAS :Dodecylbenzenesulfonic acid is a sulfonic acid that is used in the production of polyaniline. It is also used as an organic reagent that can be applied in organic synthesis, including polymerization and electrochemical studies. Dodecylbenzenesulfonic acid has been shown to react with sodium salts to form dodecyl benzene, which can be observed by synchronous fluorescence spectroscopy. This chemical has a phase transition temperature of -9°C and a boiling point of 176°C. Dodecylbenzenesulfonic acid is soluble in water vapor, but insoluble in ethanol or acetone.Formule :C18H30O3SDegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :326.5 g/mol(Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS :Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C189H284N54O56SDegré de pureté :Min. 95%Masse moléculaire :4,240.67 g/mol1-Naphthylphosphoric acid calcium
CAS :1-Naphthylphosphoric acid calcium salt (1NPAC) is a fine chemical that has been used as a building block in the synthesis of complex organic compounds. 1NPAC has been shown to be useful in the production of research chemicals and speciality chemicals. It is also employed as an intermediate for the production of high quality reagents. 1NPAC has versatile uses, as it can be used to synthesize other compounds, such as pharmaceuticals and agrochemicals.Formule :C20H18O8P2•CaDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :488.38 g/molpTH (2-38) (human) acetate salt
CAS :Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C194H314N58O53S2Degré de pureté :Min. 95%Masse moléculaire :4,371.06 g/molIL-1beta (163-171) (human) trifluoroacetate salt
CAS :Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.Formule :C39H64N12O19Degré de pureté :Min. 95%Masse moléculaire :1,004.99 g/molH-Lys-Phe-Gly-Lys-OH acetate salt
CAS :Please enquire for more information about H-Lys-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C23H38N6O5Degré de pureté :Min. 95%Masse moléculaire :478.59 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS :PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.
Formule :C33H46N8O7Degré de pureté :Min. 95%Masse moléculaire :666.77 g/molH-Arg-Ser-OH acetate salt
CAS :Produit contrôléPlease enquire for more information about H-Arg-Ser-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C9H19N5O4Degré de pureté :Min. 95%Masse moléculaire :261.28 g/moltrans-4-[(2,5-Dihydro-2,5-dioxo-1H-pyrrol-1-yl)methyl]cyclohexanecarboxylic acid
CAS :4-Maleimidomethylcyclohexanecaroboxylic acid (4MAMC) is a bifunctional molecule that is conjugated to a polymer, which has the ability to bind with cellular antigens and target tissue. It is used in clinical chemistry because it can be detected at low concentrations. 4MAMC has been shown to reduce cirrhosis caused by chronic liver injury. 4MAMC also increases the uptake of coagulation factors and decreases the expression of prothrombin, which leads to an increase in clotting time. The localization of 4MAMC is determined by the type of polymer conjugate it is bound with; for example, when it binds with human serum albumin, it localizes on the surface of cells.Formule :C12H15NO4Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :237.25 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond)
CAS :Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C54H66Cl2N12O8S2Degré de pureté :Min. 95%Masse moléculaire :1,146.22 g/molTyr-Amyloid P Component (27-38) amide trifluoroacetate salt
CAS :Please enquire for more information about Tyr-Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C77H116N20O19SDegré de pureté :Min. 95%Masse moléculaire :1,657.93 g/molCyclopenten-1-ylboronic acid
CAS :Cyclopenten-1-ylboronic acid is a chemical compound that is used in the synthesis of pharmaceuticals. It has been shown to be effective against some viruses, including Hepatitis C virus, and also against some infectious diseases such as malaria. Cyclopenten-1-ylboronic acid binds to cannabinoid receptors and may have therapeutic potential for metabolic disorders such as obesity and diabetes. The diastereomer of this chemical compound may be used as an ophthalmic drug because it has been shown to be a potent vasoconstrictor. The ring structure is similar to other drugs that are used for the treatment of Parkinson's disease, Alzheimer's disease, and epilepsy. Cyclopenten-1-ylboronic acid has two enantiomers, which means that they are mirror images of each other. One enantiomer is more potent than the other one and is more likely to bind with cannabinoid receptors and inhibit viral replication.
Formule :C5H9BO2Degré de pureté :Min. 95%Masse moléculaire :111.93 g/mol([ring-D5]Phe3)-Octreotide acetate salt
CAS :Produit contrôléPlease enquire for more information about ([ring-D5]Phe3)-Octreotide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C49H61D5N10O10S2Degré de pureté :Min. 95%Masse moléculaire :1,024.27 g/mol12-(Boc-aminooxy)-dodecanoic acid
CAS :Please enquire for more information about 12-(Boc-aminooxy)-dodecanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C17H33NO5Degré de pureté :Min. 95%Masse moléculaire :331.45 g/molBoc-epi-statine (3R,4S)-4-(Boc-amino)-3-hydroxy-6-methyl-heptanoic acid
CAS :Please enquire for more information about Boc-epi-statine (3R,4S)-4-(Boc-amino)-3-hydroxy-6-methyl-heptanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C13H25NO5Degré de pureté :Min. 95%Masse moléculaire :275.34 g/molVitamin A acetate - min 2800000 IU/g
CAS :Vitamin A acetate is a retinoid that can be used to supplement dietary intake of vitamin A. It is a synthetic retinoid and is chemically similar to retinol, the natural form of vitamin A. Vitamin A acetate has been shown to have antioxidant properties in vitro and in vivo, which are likely due to its ability to regenerate endogenous antioxidants. This agent also has pro-apoptotic effects on cells that are exposed to oxidative injury or exhibit redox potentials below -400 mV. In addition, it significantly reduces oxidative injury caused by pharmacological agents such as doxorubicin or bleomycin.Formule :C22H32O2Degré de pureté :Min 2800000 Iu/GCouleur et forme :PowderMasse moléculaire :328.49 g/molAQEE-30 (human) trifluoroacetate salt
CAS :Please enquire for more information about AQEE-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C157H252N48O56Degré de pureté :Min. 95%Masse moléculaire :3,707.97 g/molAcetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS :Please enquire for more information about Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C150H246N44O38Degré de pureté :Min. 95%Masse moléculaire :3,273.83 g/molAc-Lys-D-Ala-D-lactic acid·acetate
CAS :Produit contrôléPlease enquire for more information about Ac-Lys-D-Ala-D-lactic acid·acetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H25N3O6·C2H4O2Degré de pureté :Min. 95%Masse moléculaire :391.42 g/molNeuromedin U-25 (porcine) trifluoroacetate salt
CAS :Please enquire for more information about Neuromedin U-25 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C144H217N43O37Degré de pureté :Min. 95%Masse moléculaire :3,142.53 g/molIloprost
CAS :Iloprost is a cyclase inhibitor that is used to treat pulmonary hypertension. It relaxes the smooth muscle cells in the lungs, which causes an increase in blood flow and oxygen levels to the heart and other organs. Iloprost also decreases the production of PGE2 and lowers blood pressure. Iloprost has been shown to be effective in treating chronic viral hepatitis and pulmonary diseases such as primary pulmonary hypertension. This drug can cause hypotension, so it should not be taken by patients with low blood pressure or those who are taking other drugs that can cause hypotension.Formule :C22H32O4Degré de pureté :Min. 95%Couleur et forme :Solidified MassMasse moléculaire :360.49 g/molAmyloid beta-Protein (1-16) trifluoroacetate salt
CAS :Amyloid beta-Protein (1-16) trifluoroacetate salt is a modified form of amyloid beta protein. It is synthesized by the modification of amino acids with trifluoroacetic acid and can be used to study the pathogenesis of Alzheimer's disease. Amyloid beta-Protein (1-16) trifluoroacetate salt has been shown to bind to β-amyloid, which is thought to be the main component of plaques in Alzheimer's disease. This binding inhibits the formation of β-amyloid aggregates, which are associated with neurotoxicity and neuronal cell death.Formule :C84H119N27O28Degré de pureté :Min. 95%Masse moléculaire :1,955.01 g/mol3-Chlorophenyl acetic acid
CAS :3-Chlorophenyl acetic acid is a compound that has resonance mass of 269. The compound reacts with HBr and water to produce 3-chlorobenzene, carbon dioxide and hydrogen chloride. A reaction product of this chemical is covid-19 pandemic (a type of drug). 3-Chlorophenyl acetic acid is an organic acid that can be found in tobacco plants. It has a molecular weight of 111.07 g/mol, and its molecular formula is C6H3ClO2. The compound can exist in two forms: cis-3-chloroacrylic acid and trans-3-chloroacrylic acid. One of the two forms isomers may be more efficient than the other form for a given reaction or application.Formule :C8H7ClO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :170.59 g/molAlarin (human) trifluoroacetate salt
CAS :Alarin is a human protein that was originally developed as an antiserum to seal wounds. It is used in the manufacture of pharmaceuticals, such as vaccines and serums. Alarin has also been used in immunoassays for the detection of antibodies in blood, serum, and other body fluids. Alarin is a protein that can be biotinylated and used as a substrate for peroxidase-conjugated streptavidin. This allows it to be utilized in enzyme-linked immunosorbent assay (ELISA) tests.Formule :C127H205N43O35Degré de pureté :Min. 95%Masse moléculaire :2,894.26 g/molDimercaptosuccinic acid
CAS :Dimercaptosuccinic acid is a chemical that belongs to the class of dithiols. It has been used for the treatment of squamous cell carcinoma and urinary tract infections. Dimercaptosuccinic acid has shown long-term toxicity in rats and mice, with increased urinary bladder damage and decreased renal function. Dimercaptosuccinic acid is a fluorescent probe that can be used to diagnose oxidative injury in rats. It also binds to disulfide bonds in proteins, which can be quantified using plasma mass spectrometry.Formule :C4H6O4S2Couleur et forme :White PowderMasse moléculaire :182.22 g/molEthyl 4-bromoacetoacetate
CAS :Ethyl 4-bromoacetoacetate is a chemical compound that is used in the synthesis of quinoline derivatives. It also has antiinflammatory properties and can be used to treat inflammatory diseases such as arthritis. The thermal expansion of this compound is greater than that of water, which can be useful in treating respiratory problems by providing increased oxygen transport. Ethyl 4-bromoacetoacetate is a reactive chemical that reacts with hydrochloric acid to produce hydrogen gas and ethyl bromide gas. It also undergoes nucleophilic substitutions at the carbon atom adjacent to the acetoacetate group. This reaction solution can be analyzed using magnetic resonance spectroscopy, which produces data on the sequences of this compound's atoms and its antiinflammatory activity.Formule :C6H9BrO3Degré de pureté :90%NmrMasse moléculaire :209.04 g/molPseudin-2 trifluoroacetate salt
CAS :Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C122H202N36O32Degré de pureté :Min. 95%Masse moléculaire :2,685.13 g/mol
![([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFL110022.webp&w=3840&q=75)
![trans-4-[(2,5-Dihydro-2,5-dioxo-1H-pyrrol-1-yl)methyl]cyclohexanecarboxylic acid](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFM54570.webp&w=3840&q=75)
![([ring-D5]Phe3)-Octreotide acetate salt](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFR110015.webp&w=3840&q=75)
