Acides carboxyliques
Les acides carboxyliques sont des molécules organiques caractérisées par un groupe fonctionnel de type carboxyle (-COOH). Ces acides sont fondamentaux dans diverses réactions chimiques, y compris l'estérification, l'amidation et la décarboxylation. Les acides carboxyliques sont largement utilisés dans la production de produits pharmaceutiques, de polymères et d'agrochimiques. Dans cette section, vous pouvez trouver un grand nombre d'acides carboxyliques prêts à l'emploi. Chez CymitQuimica, nous fournissons une large gamme d'acides carboxyliques de haute qualité pour soutenir vos applications de recherche et industrielles.
12457 produits trouvés pour "Acides carboxyliques"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Fluorogenic Human CMV Protease Substrate trifluoroacetate salt
CAS :Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C73H109N23O18SDegré de pureté :Min. 95%Masse moléculaire :1,628.86 g/mol(D-His2,D-Trp6)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about (D-His2,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C64H82N18O13Degré de pureté :Min. 95%Masse moléculaire :1,311.45 g/mol3-Bromopropylboronic acid pinacol ester
CAS :Please enquire for more information about 3-Bromopropylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C9H18BBrO2Degré de pureté :Min. 95%Masse moléculaire :248.95 g/mol(D-Trp11)-Neurotensin acetate salt
CAS :Acetate saltFormule :C80H122N22O19Degré de pureté :Min. 95%Masse moléculaire :1,695.96 g/mol(d(CH2)51,Tyr(Me)2,Arg8)-Vasopressin trifluoroacetate salt
CAS :The monoclonal antibody (mAb) is a recombinant protein that binds to the extracellular region of the vasopressin receptor. It is used in pharmacological research to study the physiological function and pharmacological effects of vasopressin. The mAb has been shown to be minimally toxic, with an LD50 value of greater than 10 mg/kg in mice. It has also been shown to inhibit viruses and inhibit drug-sensitive enzymes. This antibody can be used as a diagnostic tool for congestive heart disease, as well as in experimental models for studying the minimal toxicity and tumor treatment properties of various drugs.Formule :C52H74N14O12S2Degré de pureté :Min. 95%Masse moléculaire :1,151.36 g/molHemimellitic acid
CAS :Hemimellitic acid is a carboxylate that has an intramolecular hydrogen and a reactive hydroxyl group. It can be used as a precursor to the production of polymers and plastics. Hemimellitic acid is an inorganic acid that contains nitrogen atoms. It can exist as particles with a size range between 1 and 100 nanometers. The chemical structure of hemimellitic acid is related to the malonic acid; it is the methyl ethyl ester of malonic acid. Hemimellitic acid has thermodynamic data, including a standard enthalpy change of -3,079 kJ/mol (-8,726 cal/mol) and Gibbs free energy change of -2,837 kJ/mol (-6,927 cal/mol).
Formule :C9H6O6Degré de pureté :Min. 95%Couleur et forme :White To Off-White SolidMasse moléculaire :210.14 g/molGRP (14-27) (human, porcine, canine) trifluoroacetate salt
CAS :GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.Formule :C75H110N24O16S2Degré de pureté :Min. 95%Masse moléculaire :1,667.96 g/mol(Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS :Please enquire for more information about (Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C47H74N10O14SDegré de pureté :Min. 95%Masse moléculaire :1,035.22 g/molGRF (human) acetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H358N72O66SDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :5,039.65 g/mol(D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt
CAS :Please enquire for more information about (D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C41H62N12O11Degré de pureté :Min. 95%Masse moléculaire :899.01 g/mol(Lys18)-Pseudin-2 trifluoroacetate salt
CAS :Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C122H203N37O32Degré de pureté :Min. 95%Masse moléculaire :2,700.15 g/mol2-Phenyl-5-benzimidazolesulfonic acid
CAS :2-Phenyl-5-benzimidazolesulfonic acid is a chemical compound that has been shown to have stability in vitro. It was used as a skin cancer treatment in the past, but is now mainly used as an analytical reagent. It has been shown to be effective against coumarin derivatives and enzyme activities. 2-Phenyl-5-benzimidazolesulfonic acid can be used as a chelating agent for metals and also binds to zirconium oxide, which is one of the materials used in radiation shielding. The compound can also be used for wastewater treatment and polymerase chain reaction (PCR) analysis. This compound can be synthesized using sodium salts, solid phase microextraction (SPME), and sodium citrate in order to form the benzene ring. The synthesis can then be completed by adding two phenyl groups onto the benzene ring with various reactions such as transfer reactions or radiation. Finally,Formule :C13H10N2O3SDegré de pureté :Min. 95%Masse moléculaire :274.3 g/molAc-Lys-D-Ala-D-lactic acid·acetate
CAS :Produit contrôléPlease enquire for more information about Ac-Lys-D-Ala-D-lactic acid·acetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H25N3O6·C2H4O2Degré de pureté :Min. 95%Masse moléculaire :391.42 g/mol3-Hydroxy-4-methyl-2-nitro-benzoic acid
CAS :3-Hydroxy-4-methyl-2-nitrobenzoic acid is an analog of the natural substrate for the enzyme nitroreductase. It can be used in oxidative coupling reactions to generate a covalently bonded product, which is immobilized on sepharose. 3-Hydroxy-4-methyl-2-nitrobenzoic acid has a high affinity for nucleic acids and can be used in biospecific assays. The chromophore of 3-hydroxy-4-methyl-2-nitrobenzoic acid is easily oxidized, leading to its use in nitroreduction reactions in which a nitro group is reduced to an amino group.Degré de pureté :Min. 95%Alpha-Casein (90-96) trifluoroacetate salt
CAS :Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C43H64N10O12Degré de pureté :Min. 95%Masse moléculaire :913.03 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS :Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C126H195N37O37Degré de pureté :Min. 95%Masse moléculaire :2,820.12 g/mol2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid
CAS :2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid is a fine chemical that is used in research and as a reagent. It is also used as a building block for more complex compounds and as a versatile scaffold in organic synthesis. 2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid can be reacted with other chemicals to create new compounds. This chemical has been shown to have antihistamine properties and may also function as an antipsychotic drug.Formule :C9H6BrNO5Degré de pureté :Min. 95%Masse moléculaire :288.05 g/mol2-Hydroxyethanesulfonic acid sodium salt
CAS :2-Hydroxyethanesulfonic acid sodium salt is a drug that is used to treat metabolic disorders such as cystinuria and hyperchloremic metabolic acidosis. It is also used for the treatment of water-vapor related respiratory problems and cataracts, as well as for the prevention of renal stone formation. This drug is made through electrochemical impedance spectroscopy of taurine in reaction solution with phosphorus pentoxide. 2-Hydroxyethanesulfonic acid sodium salt has been shown to increase locomotor activity in rats by improving their biochemical properties. This compound binds to the chloride ion receptor site on the Na+/K+ ATPase, causing an inhibition of the enzyme's function.Formule :C2H5O4S·NaDegré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :148.11 g/mol1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt
CAS :Please enquire for more information about 1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C39H75Na2O8PDegré de pureté :Min. 95%Masse moléculaire :748.96 g/molAQEE-30 (human) trifluoroacetate salt
CAS :Please enquire for more information about AQEE-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C157H252N48O56Degré de pureté :Min. 95%Masse moléculaire :3,707.97 g/molC-Peptide (human) trifluoroacetate salt
CAS :C-Peptide is a monoclonal antibody that binds to the β-cell and inhibits insulin release. It has been used in diagnosis of type 1 diabetes mellitus. C-Peptide is a hormone that regulates blood glucose levels by controlling the rate of glucose production in the liver, as well as by inhibiting the breakdown of glycogen in the liver. The C-terminal amino acid sequence Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu -Leu-Gly can be cleaved from the peptide by trifluoroacetic acid to yield free Gln, which can then be detected using mass spectrometry. Growth factors such as IGF1, FGF21, and HGF have been shown to increase C peptide levels in diabetic patients.Formule :C129H211N35O48Degré de pureté :Min. 95%Masse moléculaire :3,020.26 g/molNeuronostatin-19 (human, canine, porcine) trifluoroacetate salt
Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C90H151N29O25Degré de pureté :Min. 95%Masse moléculaire :2,039.34 g/molNeuromedin N trifluoroacetate salt
CAS :Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.Formule :C38H63N7O8Degré de pureté :Min. 95%Masse moléculaire :745.95 g/molH-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt
CAS :Please enquire for more information about H-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C18H35ClN4O3Degré de pureté :Min. 95%Masse moléculaire :390.95 g/molVasonatrin Peptide (VNP) trifluoroacetate salt
CAS :Please enquire for more information about Vasonatrin Peptide (VNP) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C123H198N36O36S3Degré de pureté :Min. 95%Masse moléculaire :2,853.31 g/molAc-Trp-Glu-His-Asp-AFC trifluoroacetate salt
CAS :Please enquire for more information about Ac-Trp-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C38H37F3N8O11Degré de pureté :Min. 95%Masse moléculaire :838.74 g/moltert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate
CAS :Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C13H24N2O3Degré de pureté :Min. 95%Masse moléculaire :256.34 g/molVitamin A acetate - min 2800000 IU/g
CAS :Vitamin A acetate is a retinoid that can be used to supplement dietary intake of vitamin A. It is a synthetic retinoid and is chemically similar to retinol, the natural form of vitamin A. Vitamin A acetate has been shown to have antioxidant properties in vitro and in vivo, which are likely due to its ability to regenerate endogenous antioxidants. This agent also has pro-apoptotic effects on cells that are exposed to oxidative injury or exhibit redox potentials below -400 mV. In addition, it significantly reduces oxidative injury caused by pharmacological agents such as doxorubicin or bleomycin.Formule :C22H32O2Degré de pureté :Min 2800000 Iu/GCouleur et forme :PowderMasse moléculaire :328.49 g/molZ-Val-Lys-Met-AMC acetate salt
CAS :Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.
The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.Formule :C34H45N5O7SDegré de pureté :Min. 95%Masse moléculaire :667.82 g/molMonocyte Chemotactic Protein-1 (human) acetate salt
CAS :Please enquire for more information about Monocyte Chemotactic Protein-1 (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C379H610N108O114S5Degré de pureté :Min. 95%Masse moléculaire :8,663.89 g/mol(Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C141H233N45O42Degré de pureté :Min. 95%Masse moléculaire :3,230.64 g/molSecretin (porcine) acetate salt
CAS :Produit contrôléSecretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acidsFormule :C130H220N44O41Degré de pureté :Min. 95%Masse moléculaire :3,055.41 g/molMagnesium acetate anhydrous
CAS :Magnesium acetate anhydrous is the magnesium salt of acetic acid and has been used as a polymerase chain reaction (PCR) buffer for DNA amplification. This product is also used in wastewater treatment to remove organic acids and carbonates from water. Magnesium acetate anhydrous has been shown to have a Langmuir adsorption isotherm that can be described by a single-site binding model with a Kd value of 2.8x10-2 M. The compound was found to bind to liver cells, which may be due to its hydroxyl group on the central atom of the molecule. Magnesium acetate anhydrous has been shown to have electrochemical impedance spectroscopy properties at Ω=1 MΩ-1, which are indicative of ionic conductivity and good chemical stability.Formule :C4H6MgO4Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :142.39 g/molWRW4
CAS :Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C61H65N15O6Degré de pureté :Min. 95%Masse moléculaire :1,104.27 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formule :C221H368N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,121.8 g/moltrans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate
CAS :Please enquire for more information about trans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Ovokinin trifluoroacetate salt
CAS :Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C48H67N13O11Degré de pureté :Min. 95%Masse moléculaire :1,002.13 g/mol([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt
Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%(Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C194H295N53O59SDegré de pureté :Min. 95%Masse moléculaire :4,345.81 g/molNeuropeptide FF (5-8) acetate salt
CAS :Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C25H39N9O5Degré de pureté :Min. 95%Masse moléculaire :545.63 g/molEthylene glycol monoacetoacetate monomethacrylate
CAS :Ethylene glycol monoacetoacetate monomethacrylate is a metal chelate that is used to treat muscle diseases. It has been shown to act as a gamma-aminobutyric acid agonist and inhibit the release of acetylcholine from nerve endings. This drug can also be used as a chemical stabilizer in the synthesis of polymers in organic chemistry. Ethylene glycol monoacetoacetate monomethacrylate is insoluble in water and soluble in organic solvents such as ethanol, acetone, or benzene. It has been found to have a phase transition temperature at -139°C, which is suitable for applications that require low temperatures. Ethylene glycol monoacetoacetate monomethacrylate reacts with sodium carbonate to form an ester and methacrylic acid (MAA). The reaction solution is typically heated with stirring until it reaches 40°C-50°C. The particle size ofFormule :C10H14O5Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :214.22 g/molA-VI-5 acetate salt
CAS :Please enquire for more information about A-VI-5 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C22H40N6O10Degré de pureté :Min. 95%Masse moléculaire :548.59 g/molCatestatin (human) trifluoroacetate
CAS :Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C104H164N32O27SDegré de pureté :Min. 95%Masse moléculaire :2,326.68 g/mol2-Chloropyridine-4-boronic acid
CAS :2-Chloropyridine-4-boronic acid is a nicotinic acetylcholine receptor antagonist that has been shown to be effective against trypanosomiasis. It blocks the binding of acetylcholine to its receptor, which prevents the propagation of an action potential in the postsynaptic cell. 2-Chloropyridine-4-boronic acid inhibits the enzymes cyclooxygenase and prostaglandin synthase, which are involved in inflammation. 2-Chloropyridine-4-boronic acid is potent and selective for nicotinic acetylcholine receptors, but it also binds to other sites on the enzyme. The molecular modeling studies have shown that this compound has a pharmacophore that can be used as a guide for drug design.
Formule :C5H5BClNO2Degré de pureté :Min. 95%Masse moléculaire :157.36 g/mol2,3,4,5-Tetrafluorobenzoic acid
CAS :Tetrafluorobenzoic acid is a synthetic chemical that is used in the synthesis of antimicrobial agents. Tetrafluorobenzoic acid has been shown to bind to the hydroxyl group of 2,3,4,5-tetrafluorobenzoyl chloride and form a covalent bond. The reaction solution was analyzed using crystallography and showed that there are no intermolecular hydrogen bonds between tetrafluorobenzoic acid molecules. The crystal structure was determined by X-ray diffraction analysis and found that the intramolecular hydrogen bonding may be responsible for the anti-microbial activity of this substance.
Formule :C7H2F4O2Masse moléculaire :194.08 g/molBombesin trifluoroacetate salt
CAS :Trifluoroacetate saltFormule :C71H110N24O18SDegré de pureté :Min. 95%Masse moléculaire :1,619.85 g/molAngiotensin (1-12) (human) trifluoroacetate salt
CAS :Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C73H109N19O16Degré de pureté :Min. 95%Masse moléculaire :1,508.77 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C134H180N34O26S2Degré de pureté :Min. 95%Masse moléculaire :2,747.21 g/molH-Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys-Ala-OH trifluoroacetate salt (Disulfide bond between Pen2 and Cys9)
CAS :Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.Formule :C35H57N13O14S2Degré de pureté :Min. 95%Masse moléculaire :948.04 g/molOsteoblast Activating Peptide (mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C120H196N38O37Degré de pureté :Min. 95%Masse moléculaire :2,763.07 g/mol
![2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFB66447.webp&w=3840&q=75)
![tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFB134944.webp&w=3840&q=75)
![([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFL110023.webp&w=3840&q=75)
