Anticorps primaires

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

CAPNS2 antibody was raised in Rabbit using Human CAPNS2 as the immunogen

CBLB antibody was raised in Rabbit using Human CBLB as the immunogen

The CD74 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets and binds to the CD74 protein, which plays a crucial role in immune responses. This antibody has been shown to inhibit the production of reactive oxygen species and interferon, making it a valuable tool for studying immune system regulation. Additionally, the CD74 antibody can be used to detect autoantibodies and analyze their interactions with cellular components. With its high affinity and specificity, this antibody provides reliable results in various applications such as immunohistochemistry, flow cytometry, and Western blotting. Researchers can trust the CD74 antibody to deliver accurate and reproducible results in their experiments.

Sheep polyclonal Pig Alanine Transaminase antibody

Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM

Mouse monoclonal CD51/61 antibody

Purified Polyclonal ROR gamma antibody

Rabbit polyclonal TRIP10 antibody

The Bax antibody is a chemokine globulin that is used in Life Sciences for its antiviral properties. It contains neutralizing antibodies that bind to specific proteins and colony-stimulating factors, such as GM-CSF (granulocyte-macrophage colony-stimulating factor). This polyclonal antibody has been activated and is a potent growth factor. It is formulated with excipients to ensure stability and effectiveness. The Bax antibody is commonly used in research and diagnostic applications to study cellular processes and immune responses.

OVCA2 Antibody

MRPL48 antibody was raised using the middle region of MRPL48 corresponding to a region with amino acids KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK

IFI35 antibody was raised using the N terminal of IFI35 corresponding to a region with amino acids MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL

Purified Polyclonal ADCK2 antibody

Rabbit polyclonal RGAP1 antibody

The Methcathinone Antibody is a highly specialized antibody that exhibits insulin-like properties and interferes with the function of specific antigens. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to effectively bind to recombinant proteins, growth factors, interleukins, and IFN-gamma, inhibiting their activity and preventing their interaction with target receptors. Additionally, this antibody has been immobilized on activated fatty acids, allowing for easy purification and isolation of target molecules. With its unique tyrosine-based structure, the Methcathinone Antibody offers a valuable tool for researchers in need of a reliable and efficient method for studying sumoylation processes and investigating the role of specific antigens in cellular functions.

Mouse monoclonal PRKY antibody

Rabbit polyclonal IL13 antibody (biotin)

The TAP antibody is a polyclonal antibody that is used in the field of life sciences. It is specifically designed to target and neutralize the growth factor interleukin-6 (IL-6). This antibody is highly effective in blocking the activity of IL-6, which plays a crucial role in various physiological processes such as inflammation and immune response. The TAP antibody has been extensively tested and proven to have high affinity and specificity for IL-6, making it an ideal tool for researchers studying the role of IL-6 in different biological systems. In addition, this antibody has low viscosity, allowing for easy handling and efficient use in various experimental techniques such as immunohistochemistry and Western blotting. Whether you are conducting basic research or developing therapeutics targeting IL-6, the TAP antibody is an essential tool that will provide reliable and reproducible results.

The HDAC3 antibody is a highly specialized antibody that targets the hydroxyl groups on specific proteins. It is designed to neutralize the reactive properties of these proteins, particularly c-myc. This antibody has been extensively studied in the field of Life Sciences and is widely recognized for its efficacy. It is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments. The HDAC3 antibody has also shown promising results as a protein-coupled therapeutic agent, with potential applications in cytotoxicity and inhibition of bace1 activity. Additionally, it has been found to reduce the production of reactive oxygen species, making it a valuable tool in oxidative stress research. Whether you are conducting basic research or developing new therapies, the HDAC3 antibody is an essential component of your toolkit.

FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ

RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK

Rabbit polyclonal IFN beta antibody (HRP)

RAB3IL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PTVKVAEVDCSSTNTCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITA

ACTR10 antibody was raised in Rabbit using Human ACTR10 as the immunogen

Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

Haptoglobin antibody was raised in goat using human haptoglobin as the immunogen.

The NOD2 antibody is a highly specialized protein used in the field of Life Sciences. It acts as an inhibitory factor for growth factors such as epidermal growth factor and hepatocyte growth factor. This monoclonal antibody specifically targets NOD2, a receptor involved in immune responses and inflammation. By binding to NOD2, the antibody blocks its function and prevents the activation of downstream signaling pathways. This antibody has been extensively studied and shown to be effective in various research applications, including the study of autoimmune diseases, cancer biology, and immunology. Whether you need a polyclonal or monoclonal antibody, our high-quality NOD2 antibodies are reliable tools for your research needs.

The Ibuprofen antibody is a highly specialized antibody that targets and binds to Ibuprofen, a popular nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for its growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has been conducted using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique to confirm its high efficacy on human erythrocytes. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits a strong affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture. Experience the power of 6-Fluoro

DCX antibody was raised in Rabbit using Human DCX as the immunogen

Goat anti-mouse IgG/IgM (H+L) was raised in goat using murine IgG and IgM whole molecules as the immunogen.

FITC antibody was raised in mouse using FITC-BSA conjugate as the immunogen.

The ADAM17 antibody is a monoclonal antibody that specifically targets ADAM17, also known as tumor necrosis factor-alpha converting enzyme (TACE). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.

Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT

GFP antibody (HRP) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.

AS3MT antibody was raised using a synthetic peptide corresponding to a region with amino acids GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL

SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK

TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISL

The VEGFC antibody is a monoclonal antibody that targets and neutralizes the activity of Vascular Endothelial Growth Factor C (VEGFC). This antibody plays a crucial role in inhibiting the activation of TNF-α, leukemia inhibitory factor, and other oncogenic kinases. By binding to VEGFC, this antibody prevents its interaction with its receptors, thereby inhibiting the signaling pathways involved in angiogenesis and lymphangiogenesis.

The PAR4 antibody is a potent antiviral agent that belongs to the class of antibodies. It is available in both polyclonal and monoclonal forms, with the monoclonal antibody being highly neutralizing. This antibody specifically targets the PAR4 receptor, which is involved in various cellular processes such as cyclase-activating and ketamine signaling. In the field of Life Sciences, this antibody is widely used for research purposes due to its high specificity and affinity for PAR4. It can be utilized for studying biomolecules like transferrin, low density lipoprotein (LDL), globulin, and erythropoietin. The PAR4 antibody is also commonly used in immunoassays and other analytical techniques to detect and quantify PAR4 levels. Its colloidal properties make it suitable for various applications in the biomedical field.

The PIG3 antibody is a growth factor that specifically targets epidermal growth factor (EGF). It acts as a neutralizing agent against EGF, preventing its activity and downstream signaling pathways. This monoclonal antibody is derived from histidine and has been extensively studied in the field of life sciences. It has shown promising results in preclinical studies as a potential therapeutic agent for various diseases.

MLF1 antibody was raised in Rabbit using Human MLF1 as the immunogen

CPA5 antibody was raised in Rabbit using Human CPA5 as the immunogen

PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN

DMC1 antibody was raised in Rabbit using Human DMC1 as the immunogen

IFN gamma antibody is a highly specific antibody that targets interferon gamma, a key cytokine involved in immune response regulation. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and ELISA. It specifically recognizes the carbonyl group of IFN gamma and has been extensively validated for its high affinity and specificity. It can effectively neutralize the activity of IFN gamma in vitro and in vivo, making it a valuable tool for studying the role of this cytokine in various biological processes. Whether you are investigating immune responses, studying growth factors, or exploring the effects of IFN gamma on different cell types, this antibody is an excellent choice for your research needs. Trust its reliable performance to provide accurate and reproducible results every time.

Rabbit polyclonal PBOV1 antibody

The GABAB Receptor antibody is a protein-based product that has chromatographic characteristics. It is a neutralizing antibody that targets the angptl3 protein, which is involved in various biological processes such as collagen synthesis and growth factor regulation. This monoclonal antibody specifically binds to the GABAB receptor, an important component of the central nervous system. By targeting this receptor, the antibody can modulate neurotransmission and potentially have therapeutic effects in neurological disorders. The GABAB Receptor antibody is activated upon binding to its target and can induce cytotoxic effects on cells expressing the receptor. Additionally, it may interact with other binding proteins such as epidermal growth factor and hepatocyte growth factor, further expanding its potential applications in research and medicine.

Affinity purified Rabbit polyclonal TULP1 antibody

Purified Polyclonal URI1 antibody

Rat monoclonal CD90.2 antibody (PE)

Rabbit polyclonal UGP2 antibody

CD31 antibody was raised in mouse using stimulated human Leukocytes as the immunogen.

Rabbit polyclonal PFN1 antibody (FITC)

Mouse monoclonal GSTO2 antibody

UBE2L6 antibody was raised using the N terminal of UBE2L6 corresponding to a region with amino acids LLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICL

PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII

Rabbit polyclonal MAP3K1 antibody (biotin)

Affinity purified Rabbit polyclonal Deltex1 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

The JAK1 antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the Janus kinase 1 (JAK1) protein, which plays a crucial role in various cellular processes including immune response and cell growth. By inhibiting the activity of JAK1, this antibody has antiviral properties and can be used for research purposes in studying viral infections.

Rabbit polyclonal NNT antibody

HSPA8 antibody was raised in Rabbit using Human HSPA8 as the immunogen

The GAPDH antibody is a highly specialized monoclonal antibody that targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) protein. This cysteine-rich protein plays a crucial role in various cellular processes, including glycolysis and energy metabolism. Additionally, GAPDH has been identified as an angiogenic inducer and an activated growth factor.

Affinity purified Rabbit polyclonal SUCLG1 antibody

Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.

Rabbit polyclonal SLCO2A1 antibody

Affinity purified Rabbit polyclonal CD172 gamma antibody

CD44 antibody (Allophycocyanin) was raised in rat using murine CD44 as the immunogen.

Affinity purified Rabbit polyclonal TFIID antibody

Mouse monoclonal MRPS2 antibody

MAT2B antibody was raised in Rabbit using Human MAT2B as the immunogen

Affinity purified Rabbit polyclonal TNF beta antibody

The GPR171 antibody is a highly specialized monoclonal antibody that targets the GPR171 receptor. This receptor plays a crucial role in various biological processes, including erythropoietin signaling, TNF-α production, chemokine regulation, and microvessel density. The GPR171 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of GPR171.

Goat anti-syrian hamster IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.

The GALNT7 antibody is a highly specific polyclonal antibody that targets GALNT7, an enzyme responsible for adding sugar molecules to proteins. This antibody recognizes specific acid residues in GALNT7 and can be used for various applications in life sciences research. It has been extensively validated and shown to have high affinity and specificity for GALNT7.

Mouse monoclonal POLR2J2 antibody

SFRS12IP1 antibody was raised using the middle region of SFRS12IP1 corresponding to a region with amino acids NEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKE

Rabbit polyclonal RBBP6 antibody

Rabbit polyclonal PPPDE1 antibody

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.