Anticorps primaires

SURF1 antibody was raised in rabbit using the N terminal of SURF1 as the immunogen

DDT antibody was raised using the N terminal of DDT corresponding to a region with amino acids PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS

LAP3 antibody was raised in Rabbit using Human LAP3 as the immunogen

GPR18 antibody was raised in rabbit using the middle region of GPR18 as the immunogen

FAM185A antibody was raised in Rabbit using Human FAM185A as the immunogen

The L Selectin antibody is a powerful tool for researchers studying actin filaments and protein kinases. This antibody specifically targets L Selectin, a cell surface glycoprotein involved in leukocyte adhesion and migration. By binding to L Selectin, this antibody can inhibit its function and block the interactions between leukocytes and endothelial cells.

Rabbit polyclonal CPXM2 antibody

The Progesterone receptor antibody is a highly specific monoclonal antibody that targets the progesterone receptor. It is designed to bind to the receptor and inhibit its activity, making it an essential tool for studying the role of progesterone in various biological processes.

C17ORF39 antibody was raised using the C terminal Of C17Orf39 corresponding to a region with amino acids SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR

The SH3BGRL3 antibody is a theranostic tool used in the field of Life Sciences. It plays a crucial role in various biological processes and has been extensively studied for its potential therapeutic applications. This antibody specifically targets SH3BGRL3, a proline-rich protein involved in cytokine receptor signaling and caveolin-1 regulation.

IDH3A antibody was raised in Rabbit using Human IDH3A as the immunogen

GNAL antibody was raised using a synthetic peptide corresponding to a region with amino acids AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR

The SLN antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and detect arginase, an enzyme involved in the metabolism of arginine. This antibody recognizes specific glycan structures on the arginase protein, allowing for accurate detection and quantification.

Murine anti-p26 HIV Monoclonal Antibody

Rabbit polyclonal SLCO2A1 antibody

SFRS12IP1 antibody was raised using the middle region of SFRS12IP1 corresponding to a region with amino acids NEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKE

The GAPDH antibody is a highly specialized monoclonal antibody that targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) protein. This cysteine-rich protein plays a crucial role in various cellular processes, including glycolysis and energy metabolism. Additionally, GAPDH has been identified as an angiogenic inducer and an activated growth factor.

GMPPB antibody was raised in Rabbit using Human GMPPB as the immunogen

Mouse monoclonal CXCR1 antibody

Mouse monoclonal OTUB2 antibody

Rabbit polyclonal UCHL1 antibody (biotin)

The MHC Class I antibody is a potent mitogen that belongs to the group of monoclonal antibodies. It has been extensively studied in the field of Life Sciences for its cytotoxic and growth factor properties. This antibody specifically targets and activates MHC Class I molecules, which are essential for immune recognition and response. Additionally, it has been shown to play a role in collagen immobilization and neutralizing oncolytic adenovirus. With its ability to modulate dopamine and mitogen-activated protein signaling pathways, the MHC Class I antibody is a valuable tool for research in various areas of biology and medicine.

Rabbit polyclonal OR2L5 antibody

Rabbit polyclonal ZNF238 antibody

Rabbit polyclonal Collagen V alpha 3 antibody

Mouse monoclonal anti human CREG1 antibody

KIF20A antibody was raised in Rabbit using Human KIF20A as the immunogen

The RAB32 antibody is a monoclonal antibody that targets the RAB32 protein. This protein plays a crucial role in various cellular processes, including the regulation of superoxide production and growth factor signaling. The RAB32 antibody has been shown to effectively neutralize the activity of RAB32, making it a valuable tool for researchers in the field of Life Sciences.

LACTB2 antibody was raised in Rabbit using Human LACTB2 as the immunogen

Purified Polyclonal PAX9 antibody

The GPR158 antibody is a monoclonal antibody that specifically targets GPR158, a cationic receptor involved in various biological processes. This antibody has been extensively tested and validated for its specificity and effectiveness in scientific research. It can be used in a wide range of applications, including immunohistochemistry, Western blotting, and ELISA.

IFT81 antibody was raised in Rabbit using Human IFT81 as the immunogen

IWS1 antibody was raised in Rabbit using Human IWS1 as the immunogen

Rabbit polyclonal RuBisCO antibody (HRP)

Rabbit polyclonal SLC11A2 antibody

Mouse monoclonal JEV ED3 antibody

The Smoothelin antibody is a highly specific antibody that targets smoothelin, a protein found in smooth muscle cells. It has been extensively tested and validated for use in various applications, including immunohistochemistry, western blotting, and flow cytometry. This antibody is produced using state-of-the-art techniques, ensuring high affinity and specificity. It can be used to study the role of smoothelin in various physiological and pathological processes, such as smooth muscle contraction, cardiovascular diseases, and cancer. The Smoothelin antibody is an essential tool for researchers in the field of life sciences who are interested in understanding the function of smooth muscle cells and developing potential therapeutic interventions.

The EpCAM antibody is a monoclonal antibody that specifically targets the Epithelial Cell Adhesion Molecule (EpCAM). It has been widely used in Life Sciences research for various applications. This neutralizing antibody can effectively block the interaction between EpCAM and its ligands, preventing downstream signaling events.

Human kappa light chain antibody was raised in mouse using a constantly expressed epitope of kappa chain as the immunogen.

Y14 Monoclonal Antibody (HRP)

GPSM1 antibody was raised in Rabbit using Human GPSM1 as the immunogen

Mouse monoclonal NUDT18 antibody

Mouse monoclonal NUDT6 antibody

HRP conjugated Rabbit polyclonal Ovalbumin antibody

Mouse monoclonal CD45.2 antibody (PE)

Rabbit polyclonal STX11 antibody

The RGS2 antibody is a powerful tool in the field of Life Sciences. This antibody is designed to target and inhibit the activity of RGS2, a protein involved in various cellular processes. By binding to RGS2, this antibody effectively blocks its function, leading to a cascade of downstream effects.

Protein kinase B (also known as RAC-alpha serine/threonine-protein kinase: Atk) is a serum and glucocorticoid-regulated protein kinase with three highly homologous isoforms (Akt1, 2 and 3). Akt1 and Akt3 are the predominant isoforms expressed in the brain, whereas Akt2 is mainly expressed in skeletal muscle and embryonic brown fat. These proteins play major regulatory roles in a range of physiological processes including: growth, proliferation, cell survival, angiogenesis, metabolism and Akt is also considered a proto-oncogene.Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.

Mouse monoclonal Episialin antibody

TFG antibody is a monoclonal antibody that specifically targets amyloid plaque, a hallmark of various neurodegenerative diseases. This antibody recognizes and binds to the TFG glycoprotein, which is present in amyloid plaques. By binding to these plaques, the TFG antibody helps to clear them from the brain and reduce their accumulation.

Rabbit polyclonal RPAP2 antibody

ICK antibody was raised in Rabbit using Human ICK as the immunogen

Rabbit polyclonal TNR antibody

Rabbit polyclonal Cytochrome P450 39A1 antibody

The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.

Rabbit polyclonal ISG15 antibody (HRP)

Mouse monoclonal CD105 antibody (allophycocyanin)

IL15RA antibody was raised in Rabbit using Human IL15RA as the immunogen

Mouse monoclonal NUCB1 antibody

LSM2 antibody was raised in Rabbit using Human LSM2 as the immunogen

The PBLD antibody is a highly specific monoclonal antibody that targets the chemokine receptor PBLD. It plays a crucial role in the regulation of various immune responses, including the activation and migration of immune cells. The PBLD antibody has been extensively studied for its potential therapeutic applications in cancer immunotherapy and autoimmune diseases.

LMNB2 antibody was raised in Rabbit using Human LMNB2 as the immunogen

CD23 antibody is a monoclonal antibody that specifically targets the CD23 protein, a molecule involved in various biological processes. This antibody is widely used in Life Sciences research as a tool to study the function and regulation of CD23. It can be used to detect and quantify CD23 expression levels in cells or tissues, providing valuable insights into its role in different physiological and pathological conditions. Additionally, CD23 antibody has been shown to inhibit the activity of derivatives such as ferritin and fibrinogen, suggesting its potential therapeutic applications in oxidative damage and inflammatory disorders. Furthermore, this antibody has been found to modulate hepatocyte growth factor and collagen synthesis, indicating its involvement in tissue repair and regeneration processes. With its high specificity and versatility, CD23 antibody is an indispensable tool for researchers studying various aspects of cellular signaling pathways and molecular interactions involving CD23.

RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG

Rabbit polyclonal GPR149 antibody

The Agrin antibody is a highly specialized monoclonal antibody that targets the Agrin protein. This protein is found in human serum and plays a crucial role in various cellular processes, including colony-stimulating and actin filament formation. The Agrin antibody has been extensively tested and proven to have neutralizing effects on the Agrin protein, effectively blocking its activity. One of the key features of the Agrin antibody is its ability to specifically bind to the Agrin protein, preventing it from interacting with its receptors. This targeted binding ensures that the toxic effects of excessive Agrin activity are minimized. Additionally, the Agrin antibody has shown promising results in inhibiting the growth and migration of cells that rely on Agrin signaling for their function. In addition to its neutralizing properties, the Agrin antibody has also been used as a research tool in various studies involving cell biology and molecular biology. It has been utilized in experiments investigating the role of Agrin in different biological processes, such as embryonic development

The PZP antibody is a monoclonal antibody that targets taxol and oncostatin, which are growth factors involved in various biological processes. This antibody specifically binds to the CD33 antigen, making it an effective tool for research and therapeutic applications. Monoclonal antibodies like the PZP antibody are widely used in the field of life sciences for their ability to selectively target and inhibit specific molecules or pathways. The PZP antibody can be used in hybridization experiments, as well as in the development of inhibitors or activators for CD33-related signaling pathways. It is a valuable tool for researchers studying annexin or collagen-related processes. Whether you're conducting basic research or developing new therapies, the PZP antibody is an essential component in your scientific toolkit.

The Listeria antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used in assays to detect the presence of Listeria monocytogenes, a bacterium that can cause serious infections in humans. This antibody specifically binds to nuclear antigens expressed by Listeria, allowing for easy detection and identification. The Listeria antibody is highly specific and sensitive, making it an essential tool for researchers studying this pathogen. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. With its high affinity and specificity, the Listeria antibody provides accurate and reliable results in detecting Listeria monocytogenes in samples such as human serum or colloidal suspensions. Researchers rely on this powerful tool to advance their understanding of Listeria infection and develop effective treatments.

Rabbit polyclonal USP49 antibody

HMG20B antibody was raised in Rabbit using Human HMG20B as the immunogen

Rabbit Polyclonal MRLC2 antibody (Ser18)

BCL2 antibody was raised in Rabbit using Human BCL2 as the immunogen

Rabbit polyclonal Stathmin 1 antibody (Ser15)

The MUC2 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It targets the MUC2 protein, which plays a crucial role in maintaining the integrity of the mucosal barrier in various tissues. This antibody can be used for research purposes to study the function and regulation of MUC2 in different biological processes.

The FLT1 antibody is a protein that plays a crucial role in Life Sciences. It is composed of acid residues and has been extensively studied for its various functions. This antibody specifically targets the FLT1 receptor, which is involved in regulating processes such as dopamine signaling, nuclear transport, and growth factor signaling. Additionally, it has been found to bind to antigens such as the circumsporozoite protein and ubiquitin. The FLT1 antibody has also shown potential in promoting fas-mediated apoptosis and inhibiting endothelial growth. With its versatility and wide range of applications, this antibody is an essential tool for researchers in the field of Life Sciences.

ATP13A1 antibody was raised in Rabbit using Human ATP13A1 as the immunogen

The GALNS antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. This antibody specifically targets and binds to a specific antigen, allowing for precise detection and analysis of various biological processes. In addition to its use as a diagnostic tool, the GALNS antibody has also been found to have therapeutic potential.

Mycoplasma pneumoniae antibody is a specialized protein that targets the circumsporozoite protein of the bacteria. This antibody has been shown to have anti-glial fibrillary acidic properties, acting as a growth factor and neurotrophic agent. It is a monoclonal antibody that specifically neutralizes Mycoplasma pneumoniae and has been extensively studied in the field of Life Sciences. The antibody has also been found to exhibit tyrosine phosphatase activity and has potential neuroprotective effects. With its unique properties, this Mycoplasma pneumoniae antibody offers promising applications in various research areas and can be a valuable tool for scientists studying antibodies and their functions.

The BP1 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and binds to BP1, a protein that is found in human serum. The binding of the BP1 antibody to its target protein can be used for various applications, including research and diagnostic purposes.

Monkey RBC antibody (Texas Red) was raised in rabbit using monkey erythrocytes as the immunogen.

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.