Anticorps primaires

Affinity purified Rabbit polyclonal GPR164 antibody

Rabbit polyclonal TAF1A antibody

Rabbit polyclonal Osteocalcin antibody (FITC)

The Survivin antibody is a monoclonal antibody that targets survivin, a protein that plays a crucial role in cell division and inhibition of apoptosis. This antibody specifically binds to survivin and can be used for various applications in Life Sciences research.

Rabbit polyclonal MAPT antibody

UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL

Affinity purified Rabbit polyclonal GNAS antibody

Rabbit polyclonal MRCKB antibody

The PPM1B antibody is a monoclonal antibody that targets the phosphatase enzyme PPM1B. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically recognizes and binds to PPM1B, inhibiting its activity and preventing its interaction with other molecules.

TH antibody was raised in rabbit using the n terminal of TH as the immunogen

Affinity purified Rabbit polyclonal TFEC antibody

The CLPP antibody is a monoclonal antibody that specifically targets the CLPP protein. This glycoprotein plays a crucial role in various biological processes and has been extensively studied in the field of Life Sciences. The CLPP antibody recognizes and binds to the histidine residues on the CLPP protein, allowing for accurate detection and analysis.

DUOXA1 antibody was raised in rabbit using the C terminal of DUOXA1 as the immunogen

Affinity purified Rabbit polyclonal DNA polymerase delta cat antibody

Affinity purified Rabbit polyclonal SART1 antibody

The RBP1 antibody is a monoclonal antibody that specifically targets the TGF-beta1 protein. It can be used in various research applications in Life Sciences, such as studying the effects of TGF-beta1 on cellular processes and signaling pathways. The RBP1 antibody has been shown to neutralize the activity of TGF-beta1, which plays a crucial role in cell growth, differentiation, and immune response regulation. Additionally, this antibody can be used in combination with other antibodies or drugs, such as imatinib or interferon, to investigate potential synergistic effects. Its high specificity and affinity make it an excellent tool for studying TGF-beta1-related mechanisms and developing therapeutic interventions.

ALDH1B1 antibody was raised in Rabbit using Human ALDH1B1 as the immunogen

Rabbit polyclonal 5HT1A antibody

NHP2L1 antibody was raised in Rabbit using Human NHP2L1 as the immunogen

Rabbit polyclonal PITPNM1 antibody

The Beta Lactoglobulin antibody is a polyclonal antibody that is immobilized and used as an inhibitor of CD20 antibodies. It specifically targets the beta lactoglobulin antigen, which is a glycoprotein found in milk. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. It can be used in various applications, including research on proproteins, monoclonal antibodies, antibody-drug conjugates, cytotoxicity assays, chemokine studies, and the production of recombinant proteins. With its high specificity and affinity for the target antigen, the Beta Lactoglobulin antibody offers great potential for advancing scientific discoveries in various fields.

The Src antibody is a specific antibody used in Life Sciences research. It targets protein tyrosine kinases, specifically the Src family of kinases. This antibody has been shown to induce apoptosis in various cell types by activating the TNF-related apoptosis-inducing ligand (TRAIL) pathway. It can also inhibit the activity of interferon and epidermal growth factor signaling pathways. The Src antibody is available in stable liquid formulations for easy handling and storage. Whether you need a monoclonal or polyclonal antibody, the Src antibody is a reliable choice for your research needs. Additionally, studies have suggested that this antibody may have potential therapeutic applications in conditions such as hepatic steatosis.

Affinity purified Rabbit polyclonal Copine 3 antibody

Affinity purified Rabbit polyclonal SNTB2 antibody

Affinity purified Rabbit polyclonal ST3GAL2 antibody

The Connexin 43 antibody is a highly specialized antibody used in Life Sciences research. It targets the protein Connexin 43, which plays a crucial role in cell communication and signaling. This antibody is available in both polyclonal and monoclonal forms.

ATP1B1 antibody was raised in Rabbit using Human ATP1B1 as the immunogen

Haptoglobin antibody is a highly versatile and potent growth factor that acts as an angiogenic inducer. It plays a crucial role in various biological processes such as reactive oxygen species regulation, cytotoxic activity, chemokine modulation, and transmembrane conductance. This polyclonal antibody is specifically designed for use in Life Sciences research, making it an essential tool for scientists studying various aspects of cellular function. In addition to its broad range of applications, haptoglobin antibody has been extensively studied and validated in different experimental settings. Its high specificity and affinity make it a valuable tool for detecting and quantifying haptoglobin levels in various samples. Whether you are conducting basic research or developing diagnostic assays, this monoclonal antibody will provide accurate and reliable results. With its ability to bind to the glycoprotein haptoglobin with exceptional precision, this antibody enables researchers to gain deeper insights into the mechanisms underlying disease progression and therapeutic interventions. Don't miss out on the opportunity to enhance your research capabilities with

Rabbit polyclonal OLFM2 antibody

Affinity purified Rabbit polyclonal C1orf57 antibody

Also known as Protein Kinase B (PKB), Akt is a signaling protein in cells that regulates important processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth. This pathway is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. Akt can then influence downstream processes, inhibiting apoptosis to promote cell survival, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism.Akt plays a key role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.

The Prefoldin 5 antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets transthyretin, an important protein involved in various biological processes. The antibody-drug complex can be immobilized on an electrode surface and activated under acidic conditions. This enables researchers to study the interaction between transthyretin and other molecules such as chemokines, interferons, and monoclonal antibodies. The Prefoldin 5 antibody is widely used in techniques like immunohistochemistry to visualize the distribution of transthyretin in tissues. With its high specificity and sensitivity, this antibody is an invaluable asset for any researcher working in the field of Life Sciences.

The Dopamine beta Hydroxylase antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to dopamine beta hydroxylase, an enzyme involved in the synthesis of norepinephrine. This antibody is commonly used in research and diagnostic assays to study the role of dopamine beta hydroxylase in various biological processes.

Affinity purified Rabbit polyclonal DYNC1I2 antibody

The Troponin T antibody is an immunosuppressant that belongs to the group of polyclonal antibodies. It specifically targets calmodulin, a protein involved in muscle contraction and relaxation. This antibody is buffered and has neutralizing properties, making it highly effective in inhibiting the activity of calmodulin. In addition to its immunosuppressive effects, the Troponin T antibody has been shown to promote the growth of factors that regulate cell proliferation and differentiation. It also exhibits diuretic properties by enhancing the excretion of fluids from the body. This antibody is widely used in life sciences research, particularly in studies involving interleukin-6 and other cytokines. The Troponin T antibody is available as a monoclonal antibody, which ensures high specificity and affinity for its target antigen. Its versatility extends beyond research applications, as it can also be used for diagnostic purposes, such as detecting influenza hemagglutinin or monitoring signaling pathways involving PI3-kinase

The PP2A antibody is a highly specialized electrode used for the detection and analysis of Polyclonal Antibodies. This antibody is specifically designed to target and bind to adipocyte markers, allowing for accurate identification and characterization of these cells. The PP2A antibody has been shown to be effective in detecting acidic glycosylation patterns on adipocytes, which play a crucial role in their function and metabolism. Additionally, this antibody has been found to modulate superoxide production in adipocytes, suggesting a potential therapeutic application in oxidative stress-related disorders. Furthermore, studies have shown that the PP2A antibody can enhance e-cadherin expression in adipocytes, promoting cellular adhesion and insulin sensitivity. With its high specificity and sensitivity, the PP2A antibody is an invaluable tool for researchers in the field of Life Sciences studying interferon signaling pathways, adipose tissue biology, fatty acid metabolism, and more.

Rabbit polyclonal EGF antibody (biotin)

Rabbit polyclonal PCSK5 antibody

The GPR81 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets GPR81, a receptor involved in various cellular processes. This antibody has been extensively validated through cytotoxic assays and transcription-polymerase chain reaction (PCR) experiments.

Factor VII antibody is a polyclonal antibody that targets the activated form of factor VII, a surface glycoprotein involved in the coagulation cascade. This antibody has been widely used in life sciences research to study the role of factor VII in various physiological processes. It has been shown to inhibit factor VII activity and gluconeogenesis in vitro. Additionally, this antibody has been used as a tool in multi-agent chemotherapy studies to investigate its potential therapeutic effects. Factor VII antibody can be used in various applications such as immunoassays, electrophoresis, and Western blotting to detect and quantify factor VII levels in samples. Its high specificity and sensitivity make it an essential tool for researchers studying coagulation pathways and related disorders.

AKR1C1 antibody was raised in mouse using recombinant human AKR1C1 (1-323aa) purified from E. coli as the immunogen.

Rabbit polyclonal TLR2 antibody (Middle Region)

The HIPK2 antibody is a highly specialized tool used in Life Sciences research. It is a Polyclonal Antibody that is designed for the ultrasensitive detection and neutralization of clostridial neurotoxins. The antibody can be immobilized on a carbon electrode, allowing for electrochemical impedance spectroscopy to be performed. This technique enables researchers to accurately measure the presence and activity of the toxins in various samples.

ACTA1 antibody was raised in rabbit using the N terminal of ACTA1 as the immunogen

The DKK3 antibody is a polyclonal antibody that specifically targets the glycoprotein DKK3. It is commonly used in life sciences research to study the role of DKK3 in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit cytotoxic effects induced by insulin. Additionally, it has been found to possess anticoagulant activity and can bind to phospholipids, making it useful for studying antiphospholipid antibodies. The DKK3 antibody is a valuable tool for researchers investigating the function and therapeutic potential of DKK3 in different contexts.

The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.

Rabbit polyclonal ALAS1 antibody raised against the N terminal of ALAS1

Affinity purified Rabbit polyclonal G-Catenin antibody

The C1R antibody is a highly specialized protein that plays a crucial role in various life sciences applications. This antibody is specifically designed to target and neutralize the activity of certain proteins, such as growth factors and autoantibodies, which are involved in various biological processes.

KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

The ZO1 antibody is a highly effective monoclonal antibody that specifically targets CD33, a cell surface protein. This antibody is widely used in the field of life sciences for various applications. It has been shown to inhibit the growth of cancer cells, such as MCF-7 breast cancer cells, by blocking the action of growth factors and interfering with cell signaling pathways. Additionally, the ZO1 antibody has been used in research involving mesenchymal stem cells to study their differentiation potential and therapeutic applications. Furthermore, this antibody can be utilized in immunohistochemistry and western blotting assays to detect and quantify specific proteins of interest. With its exceptional specificity and sensitivity, the ZO1 antibody is an invaluable tool for scientists and researchers in their quest for new discoveries in the field of molecular biology.

The Prolactin Receptor antibody is a growth factor that belongs to the class of monoclonal antibodies. It has neutralizing properties and can effectively inhibit the activity of prolactin, a hormone involved in lactation and reproductive functions. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.

MYO7B antibody was raised in Rabbit using Human MYO7B as the immunogen

IBSP antibody was raised using a synthetic peptide corresponding to a region with amino acids SATTLGYGEDATPGTGYTGLAAIQLPKKAGDITNKATKEKESDEEEEEEE

The N Cadherin antibody is a trifunctional antibody that has various applications in the field of Life Sciences. It can be used for research purposes, such as studying growth factors and their interactions with human serum. This antibody is commonly used in laboratory settings and can be used in experiments involving electrodes and other scientific equipment.

GCLM antibody was raised in Rabbit using Human GCLM as the immunogen

The K2 antibody is a highly effective nucleotide molecule that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This anti-her2 antibody-drug conjugate specifically binds to the HER2 receptor, which is overexpressed in certain types of cancer cells. It works by inhibiting the epidermal growth factor signaling pathway, preventing the growth and proliferation of cancer cells.

RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA

Affinity purified Rabbit polyclonal Neuregulin 2 antibody

Affinity purified Mouse polyclonal XRCC1 antibody

Affinity purified Rabbit polyclonal HHIP antibody

CD19 antibody (Azide free) was raised in mouse using human CD19 as the immunogen.

Affinity purified Rabbit polyclonal BCLx antibody

The HBcAg antibody is a reactive antibody that is used in various applications in the field of life sciences. It is commonly used for its neutralizing properties against antiphospholipid antibodies and anti-HER2 antibodies. This polyclonal antibody has been extensively studied and has shown high specificity and affinity towards its target antigens.

The MCM3 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets MCM3, a protein biomarker involved in various cellular processes. This antibody can be used in immunoassay tests to detect and quantify MCM3 levels in samples, providing valuable insights into cell cycle regulation, DNA replication, and other essential biological functions.

ABHD14B antibody was raised in Rabbit using Human ABHD14B as the immunogen

NINJ2 antibody was raised in Rabbit using Human NINJ2 as the immunogen

Affinity purified Rabbit polyclonal PRPS2 antibody

The APP antibody is a powerful tool used in medical research and diagnostics. It specifically targets alpha-fetoprotein (AFP), which is an important biomarker for various diseases, including liver cancer. The APP antibody binds to amyloid plaques, which are abnormal protein deposits found in the brains of individuals with Alzheimer's disease. This antibody can also be used to study growth factors and their binding proteins, providing valuable insights into cellular processes and signaling pathways.

Affinity purified Rabbit polyclonal ENTPD6 antibody

Rabbit polyclonal RPS14 antibody (biotin)

RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP

Affinity purified Rabbit polyclonal Integrin alpha 2b antibody

Affinity purified Rabbit polyclonal KLRC4 antibody

CTSL2 antibody was raised in rabbit using the C terminal of CTSL2 as the immunogen

U1SNRNPBP antibody was raised using the N terminal of U1SNRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR

DCX antibody was raised in Rabbit using Human DCX as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for its growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has been conducted using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique to confirm its high efficacy on human erythrocytes. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits a strong affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture. Experience the power of 6-Fluoro

The Ibuprofen antibody is a highly specialized antibody that targets and binds to Ibuprofen, a popular nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.

The NOD2 antibody is a highly specialized protein used in the field of Life Sciences. It acts as an inhibitory factor for growth factors such as epidermal growth factor and hepatocyte growth factor. This monoclonal antibody specifically targets NOD2, a receptor involved in immune responses and inflammation. By binding to NOD2, the antibody blocks its function and prevents the activation of downstream signaling pathways. This antibody has been extensively studied and shown to be effective in various research applications, including the study of autoimmune diseases, cancer biology, and immunology. Whether you need a polyclonal or monoclonal antibody, our high-quality NOD2 antibodies are reliable tools for your research needs.

Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

ACTR10 antibody was raised in Rabbit using Human ACTR10 as the immunogen

RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK

FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ

Metaxin 2 antibody was raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.