Anticorps primaires

Affinity purified Rabbit polyclonal ARHGEF18 antibody

Estrogen Receptor antibody was raised in Mouse using a purified recombinant fragment of ESR1(aa301-595) expressed in E. coli as the immunogen.

Rabbit polyclonal BLOC1 antibody

The CLCA1 antibody is a neutralizing monoclonal antibody that is widely used in Life Sciences research. It specifically targets CLCA1, a protein involved in various biological processes including the regulation of epidermal growth factor and hepatocyte growth factor. This antibody has been shown to inhibit the activity of CLCA1 by binding to its target site, preventing its interaction with other proteins or growth factors. In addition, the CLCA1 antibody can be used for immobilization studies or as a tool for detecting CLCA1 dimers in experimental settings. Its high specificity and affinity make it an essential tool for researchers studying the role of CLCA1 in different cellular processes.

Rabbit polyclonal MAD4 antibody

Luteinizing hormone beta antibody was raised in mouse using human LH as the immunogen.

Purified Rabbit polyclonal FADD antibody (Ser191)

Purified Polyclonal PLA2G4C antibody

Rabbit polyclonal MAP2K7 antibody (Ser271)

GLRX2 antibody was raised in Rabbit using Human GLRX2 as the immunogen

BAI1 antibody was raised in rabbit using a synthetic peptide conjugated to KLHd as the immunogen.

The IL15Ra antibody is a highly specialized antibody used in Life Sciences research. It targets the IL-15 receptor alpha chain, which plays a crucial role in immune response and cell proliferation. This antibody is commonly used in studies involving colony-stimulating factors and macrophage colony-stimulating factors.

The GAPDH antibody is a highly effective polyclonal antibody that is capable of neutralizing the activity of glyceraldehyde-3-phosphate dehydrogenase (GAPDH). This antibody has been extensively tested and shown to effectively inhibit the function of GAPDH in various experimental settings.

Rat monoclonal CD144 antibody (PE)

Purified Polyclonal ADCK2 antibody

Mouse monoclonal STAT4 antibody

CD28 antibody (biotin) was raised in mouse using chicken CD28 as the immunogen.

Purified Rabbit polyclonal RACK1A antibody

The CD80 antibody is a highly effective and versatile tool in the field of Life Sciences. This monoclonal antibody has a colloidal structure that allows it to efficiently bind to collagen and other target molecules. It is commonly used in research and diagnostic applications, particularly in the study of TGF-beta signaling pathways.

The MKK3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to alpha-fetoprotein, a glycoprotein that plays a crucial role in various biological processes. This antibody can be used in a variety of assays, including immunohistochemistry and Western blotting, to detect and quantify the presence of alpha-fetoprotein in samples.

The LXN antibody is a monoclonal antibody that is used to detect and study angiogenic factors. It can be used in various research applications, including immunohistochemistry and Western blotting. The LXN antibody specifically recognizes and binds to a target protein, allowing for the detection and analysis of its expression levels. This antibody has been shown to inhibit syncytia formation and block the activity of certain growth factors. Additionally, it has been found to have cholinergic activity and can modulate the function of nucleotide molecules. The LXN antibody is available as a ready-to-use solution and can be easily incorporated into experimental protocols.

Rabbit polyclonal RPS25 antibody (FITC)

Rabbit polyclonal PA2G4 antibody

DPP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Rabbit polyclonal RPS6KB2 antibody

CAPN2 antibody was raised in Rabbit using Human CAPN2 as the immunogen

The Caspase 6 antibody is a highly effective monoclonal antibody used in Life Sciences. This glycoprotein antibody specifically targets caspase 6, an enzyme involved in programmed cell death. By binding to caspase 6, this antibody inhibits its activity and prevents the initiation of apoptosis.

Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen

FICD antibody was raised using the C terminal Of Ficd corresponding to a region with amino acids FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY

Affinity purified Rabbit polyclonal XPNPEP2 antibody

Mouse monoclonal anti human C1QBP antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

The NR1H3 antibody is a highly specialized monoclonal antibody that targets the chemokine receptor NR1H3. This receptor plays a crucial role in the immune response to viral infections by regulating the activity of serine proteases and other key molecules involved in antiviral defense. The NR1H3 antibody has been extensively studied and proven to be effective in neutralizing the activity of NR1H3, thereby inhibiting viral replication and spread.

Rabbit polyclonal UBL4B antibody

GUCY1A3 antibody was raised in Rabbit using Human GUCY1A3 as the immunogen

The CYP2D6 antibody is a polyclonal antibody that specifically targets the CYP2D6 enzyme. This enzyme is responsible for metabolizing a wide range of drugs, including bufuralol and interferon. The CYP2D6 antibody recognizes immunodominant epitopes on the enzyme and can be used in various research applications.

The SERP1 antibody is a polyclonal antibody that targets nuclear and adipose tissues. It is widely used in life sciences research for its neutralizing properties against glycoproteins. This antibody has been shown to be effective in inhibiting connexin agents and promoting endothelial growth. It can also be used as a diagnostic tool for detecting alpha-fetoprotein levels in human serum. The SERP1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its high specificity and affinity, this antibody is an essential tool for studying various biological processes and diseases.

Rabbit polyclonal Gag-Pol antibody

Rabbit polyclonal PPIA antibody (FITC)

The SOX13 antibody is a highly specialized monoclonal antibody that targets the SOX13 protein. This protein is involved in various cellular processes, including nephrotoxicity, fibrinogen production, and regulation of endogenous hematopoietic stem cells. The SOX13 antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the activity of this protein.

TMEM59L antibody was raised using the N terminal of TMEM59L corresponding to a region with amino acids PAASAPSARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDR

Rabbit polyclonal PCBP4 antibody

CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS

FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Synaptopodin antibody was raised in mouse using rat kidney glomeruli as the immunogen.

The PIAS4 antibody is a highly specialized polyclonal antibody used in Life Sciences research. This antibody specifically targets the protein known as PIAS4, which stands for Protein Inhibitor of Activated STAT 4. PIAS4 is involved in various cellular processes, including epidermal growth factor signaling and interferon response.

Rabbit polyclonal CRP antibody (HRP)

ACSL3 antibody was raised in Rabbit using Human ACSL3 as the immunogen

Rabbit polyclonal VTI1A antibody

MINA antibody was raised in Rabbit using Human MINA as the immunogen

Affinity purified Rabbit polyclonal TXNDC3 antibody

Affinity purified Rabbit polyclonal Edc3 antibody

Rabbit polyclonal MUC1 antibody (FITC)

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL

CDC16 antibody was raised in Rabbit using Human CDC16 as the immunogen

Rabbit polyclonal SLC27A3 antibody

Affinity purified Rabbit polyclonal SPG7 antibody

SURF6 antibody was raised using the N terminal of SURF6 corresponding to a region with amino acids ICSHSAPEQQARTRAGKTQGSETAGPPKKKRKKTQKKFRKREEKAAEHKA

The NR4A1 antibody is a monoclonal antibody that targets the cholinergic receptor NR4A1. It has been extensively studied in the field of Life Sciences and has shown promising results in various assays. This antibody has been found to be effective in inhibiting the activity of NR4A1, which plays a crucial role in thrombocytopenia and other related conditions. The NR4A1 antibody works by binding to the receptor and blocking its function, leading to a decrease in platelet production. In addition, this antibody has also been used in research studies involving histidine and epidermal growth factor, further highlighting its versatility. With its cytotoxic properties and ability to inhibit choline acetyltransferase, the NR4A1 antibody holds great potential for therapeutic applications. It is available as both a monoclonal and polyclonal antibody, making it suitable for various research needs.

ATP6V1B2 antibody was raised using the middle region of ATP6V1B2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK

Rabbit polyclonal RGAP1 antibody

The EEF2 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It binds to and detects the eukaryotic elongation factor 2 (EEF2) protein, which plays a crucial role in protein synthesis. This antibody has been extensively validated for various applications, including immunohistochemistry, western blotting, and flow cytometry.

Lamin Type A and C antibody was raised in mouse using Nuclear pore complex-lamina fraction of bovine liver as the immunogen.

Affinity purified Rabbit polyclonal Malectin antibody

GALNTL2 antibody was raised in Rabbit using Human GALNTL2 as the immunogen

CLYBL antibody was raised in Rabbit using Human CLYBL as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

Brachyury antibody was raised in rabbit using the internal sequence of the human Brachyury protein as the immunogen.

Rabbit polyclonal KCY antibody

CD22 antibody (FITC) was raised in rat using CD22 as the immunogen.

Rabbit polyclonal TNFRSF13B antibody

BATF antibody was raised in Rabbit using Human BATF as the immunogen

GPX7 antibody was raised in Rabbit using Human GPX7 as the immunogen

Rabbit polyclonal APC5 antibody

TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.

Rabbit polyclonal TUBB3 antibody (biotin)

The PFK antibody is a highly specialized polymerase enzyme that acts as a neutralizing agent. It is a monoclonal antibody specifically designed to target collagen and inhibit its activity. This antibody has shown great potential in the field of Life Sciences, particularly in research related to TGF-beta1, albumin, phosphatase, growth factors, interferon, glutamate, and dopamine. Its unique mechanism of action makes it an invaluable tool for studying various biological processes and pathways. Whether you're conducting experiments or exploring new therapeutic avenues, the PFK antibody is sure to be an asset in your scientific endeavors.

The FAN antibody is a highly versatile and effective tool used in various assays and hybridization techniques. It is an isothiocyanate-conjugated monoclonal antibody that specifically targets alpha-fetoprotein (AFP). This antibody has been widely used in research and diagnostic applications for the detection and quantification of AFP in biological samples.

The TS antibody is an autoantibody that specifically targets glial fibrillary acidic protein (GFAP), a protein found in the central nervous system. It is commonly used in life sciences research to study the role of GFAP in various cellular processes. The TS antibody recognizes specific epitopes on GFAP and can be used for immunohistochemistry, immunocytochemistry, and Western blotting applications. This monoclonal antibody has high specificity and sensitivity, making it a valuable tool for studying GFAP expression and function. Additionally, the TS antibody can be conjugated with different fluorophores or enzymes for multiplexing experiments or detection purposes. Whether you're researching neurodegenerative diseases or investigating cellular responses to growth factors, the TS antibody is an essential reagent for your experiments. Trust its reliability and performance to deliver accurate and reproducible results in your scientific endeavors.

The HSA antibody is a monoclonal antibody that is commonly used in steroid assays and other diagnostic tests involving human serum. It has been shown to have an inhibitory effect on the activity of certain antibodies, making it a valuable tool in research and medical settings. This specific monoclonal antibody has also been found to have anti-mesothelin properties, which makes it useful in the study and treatment of mesothelioma, a type of cancer. Additionally, the HSA antibody has demonstrated antioxidant activity and the ability to inhibit the growth factor in certain cell lines. Its versatility and wide range of applications make it an essential tool in the field of life sciences.

ALDH3B1 antibody was raised using the N terminal of ALDH3B1 corresponding to a region with amino acids DPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQD

CAPN7 antibody was raised in Rabbit using Human CAPN7 as the immunogen

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.