Anticorps primaires

IL27 antibody was raised in rabbit using the C terminal of IL27 as the immunogen

NDOR1 antibody was raised in Rabbit using Human NDOR1 as the immunogen

The FUS antibody is a polyclonal antibody that specifically targets the FUS protein. It recognizes the glycan structure present on the FUS protein and has neutralizing properties, making it an effective tool for studying the function of this protein. The FUS antibody can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. It has been shown to have neuroprotective effects and can be used as a therapeutic agent in neurodegenerative diseases. Additionally, the FUS antibody can be used to study glycosylation processes and investigate the role of glycopeptides in cellular functions. In life sciences research, this antibody is widely used as an anti-connexin agent due to its ability to disrupt gap junctions between cells. Furthermore, it has been found to interact with collagen, suggesting potential applications in tissue engineering and regenerative medicine.

Affinity purified Rabbit polyclonal IL17 Receptor D antibody

The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.

Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL

The BAK1 antibody is a test compound used in Life Sciences research. It is a protein reagent that is commonly used in the field of Antibodies. This antibody specifically targets hematopoietic cells and can be used to study their function in various biological processes. The BAK1 antibody has high affinity for its target and can be used as an inhibitor to block specific interactions or signaling pathways. Additionally, it has been shown to have therapeutic potential in the field of pluripotent stem cell research, where it can be used to manipulate DNA double-strand breaks and promote cellular differentiation. With its versatility and wide range of applications, the BAK1 antibody is an essential tool for researchers in the Life Sciences field.

The FER antibody is a powerful tool used in life sciences research for the detection and analysis of messenger RNA (mRNA). It belongs to the category of antibodies, specifically polyclonal antibodies. This cytotoxic antibody is designed to target specific proteins, particularly glycoproteins, and can be used for various applications such as protein immobilization and chromatographic purification. The FER antibody has the unique ability to neutralize binding proteins, including growth factors like hepatocyte growth factor and angiopoietin-like 3 (ANGPTL3). Its high specificity and sensitivity make it an invaluable asset in the field of molecular biology and biomedical research.

Affinity purified Goat polyclonal Presenilin 2 antibody

The RPA70 antibody is a highly specific reagent used in scientific research for various applications. It is commonly used in polymerase chain reactions (PCR) and immunohistochemical detection to study protein-protein interactions and cellular processes. This polyclonal antibody recognizes the RPA70 protein, which plays a crucial role in DNA replication and repair.

Affinity purified Rabbit polyclonal GIMAP8 antibody

The RALB antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the RALB protein, which plays a crucial role in various cellular processes such as epidermal growth factor signaling, low-molecular-weight chemokine production, and endothelial cell growth. This antibody has been extensively used in research to study the function and regulation of RALB.

Affinity purified Rabbit polyclonal Glucocorticoid Receptor beta antibody

The IDO antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets the enzyme indoleamine 2,3-dioxygenase (IDO). This enzyme plays a crucial role in the regulation of immune responses and is involved in various physiological processes. The IDO antibody has been extensively used to study the function and activity of IDO in different cell types and tissues.

The CNPase antibody is a highly specialized monoclonal antibody that is used in various research and diagnostic applications. It is specifically designed to target and bind to CNPase, an enzyme that plays a crucial role in the central nervous system. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting CNPase in human serum samples.

Affinity purified Rabbit polyclonal C5L2 antibody

RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

The MPP1 antibody is a powerful tool in the field of life sciences. It belongs to the class of antibodies and specifically targets interleukin, an important cytokine involved in various immune responses. This antibody can be used in assays and experiments to detect and measure the levels of interleukin in samples. It is also useful for studying autoantibodies, which are antibodies that target the body's own tissues.

The CDK2 antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to cyclin-dependent kinase 2 (CDK2), a protein that plays a crucial role in cell cycle regulation. By binding to CDK2, this antibody can inhibit its activity and prevent cell division.

Armenian Hamster monoclonal CD49e antibody (FITC)

Affinity purified Rabbit polyclonal ADAMTSL2 antibody

Affinity purified Rabbit polyclonal PEX19 antibody

The GAD65 antibody is a multidrug growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets and binds to GAD65, an enzyme involved in the production of insulin and glucagon. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to diabetes and autoimmune disorders.

The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.

Rabbit polyclonal ALAS1 antibody raised against the N terminal of ALAS1

Affinity purified Rabbit polyclonal G-Catenin antibody

Rabbit polyclonal DGKQ antibody

ACADVL antibody was raised in Rabbit using Human ACADVL as the immunogen

Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD

CCNE2 antibody was raised in rabbit using the N terminal of CCNE2 as the immunogen

Affinity purified Rabbit polyclonal IP6K1 antibody

Affinity purified Rabbit polyclonal SCIN antibody

Rabbit polyclonal GPR176 antibody

Affinity purified Mouse polyclonal DAPK2 antibody

CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen

CCR4 antibody was raised in rabbit using the middle region of CCR4 as the immunogen

Affinity purified Rabbit polyclonal TCP1 beta antibody

Affinity purified Rabbit polyclonal XRCC3 antibody

Affinity purified Rabbit polyclonal SLC25A33 antibody

CSB antibody is a high-quality polyclonal antibody that targets specific proteins and antigens in various life science applications. This antibody is widely used in research and diagnostics due to its exceptional sensitivity and specificity. It has been extensively validated for its ability to detect and neutralize a wide range of target proteins, including neurotrophic factors, glucagon, endothelial growth factors, and more. The CSB antibody utilizes advanced phosphatase technology and colloidal electrodes to ensure accurate and reliable results. Whether you are studying protein expression, conducting immunoassays, or investigating cellular pathways, the CSB antibody is an indispensable tool for your research needs. Trust in its superior performance to accelerate your scientific discoveries.

CPA3 antibody was raised in Rabbit using Human CPA3 as the immunogen

Affinity purified Rabbit polyclonal GSTM1 antibody

The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.

KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE

Affinity purified Rabbit polyclonal Cofilin 2 antibody

Rabbit polyclonal IKK gamma antibody

Rabbit polyclonal CKS1 antibody

The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.

Affinity purified Rabbit polyclonal CBFA1 antibody

TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen

Eotaxin 3 antibody (biotin) was raised in goat using highly pure recombinant human eotaxin-3 as the immunogen.

Affinity purified Rabbit polyclonal MCH1R antibody

Affinity purified Rabbit polyclonal RBPJ kappa antibody

The CIAPIN1 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the CIAPIN1 protein. This protein has been shown to play a crucial role in various cellular processes, including cell growth, apoptosis, and immune response.

Affinity purified Rabbit polyclonal MUS81 antibody

CD3E antibody was raised in Rabbit using Human CD3E as the immunogen

Collagen type II antibody was raised in mouse using purified preparation of lathritic type II collagen from embryonic chicken sternum as the immunogen.

HTR7 antibody was raised in rabbit using the N terminal of HTR7 as the immunogen

Rabbit polyclonal PPIL1 antibody

The COL4A5 antibody is a monoclonal antibody that specifically targets the collagen type IV alpha 5 chain. It can be used in various applications in Life Sciences research. This antibody has been shown to bind to collagen type IV and inhibit its activity, making it a valuable tool for studying the role of collagen in various cellular processes. Additionally, the COL4A5 antibody has been used in experiments involving creatine kinase activation and family kinase inhibition. Its efficacy has also been demonstrated in electrode-based assays. This antibody is highly specific and shows minimal cross-reactivity with other proteins. It is available as both a monoclonal and polyclonal antibody, allowing researchers to choose the most suitable option for their experiments. The COL4A5 antibody is an essential tool for investigating the functions and mechanisms of collagen type IV and its associated pathways.

Rabbit polyclonal Coflin 1 and Cofilin 2 antibody

RNF212 antibody was raised using the middle region of RNF212 corresponding to a region with amino acids LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS

Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.

MCM2 antibody was raised in Rabbit using Human MCM2 as the immunogen

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.

Lipoprotein Lipase Monoclonal Antibody Biotin

Rabbit polyclonal SLC25A6 antibody

NSE antibody was raised in mouse using NSE from the human brain as the immunogen.

Goat anti-human IgG (H+L) (FITC) was raised in goat using human IgG whole molecule as the immunogen.

PTCH1 antibody was raised in rabbit using residues 269-279 [KKINYQVDSWE] of the murine PTCH protein as the immunogen.

The MKK6 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It specifically targets the activated form of MKK6, a key enzyme involved in the natriuretic signaling pathway. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting MKK6 activation in various experimental settings.

IgM antibody was raised in Mouse using recombinant human IgM as the immunogen.

The ACADL antibody is a neurotrophic factor monoclonal antibody that has shown promising results in various studies. This antibody acts as a growth factor and has the ability to promote cell survival and differentiation. It can be used in research settings to study the effects of neurotrophic factors on neuronal development and function.

PSMC5 antibody was raised in rabbit using the C terminal of PSMC5 as the immunogen

Purified Polyclonal PLA2G4C antibody

BTBD12 antibody was raised in rabbit using the N terminal of BTBD12 as the immunogen

Rabbit polyclonal YPEL1 antibody

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.