Anticorps primaires

DIDO1 antibody was raised in rabbit using the C terminal of DIDO1 as the immunogen

MEPE antibody was raised in rabbit using the middle region of MEPE as the immunogen

ZBTB43 antibody was raised in rabbit using the N terminal of ZBTB43 as the immunogen

TAZ antibody was raised in rabbit using residures 386-400 [VESALNKSEPFLTWL] of the 49kDa human TAZ protein as the immunogen.

ZNF275 antibody was raised in rabbit using the N terminal of ZNF275 as the immunogen

RAB15 antibody was raised using the N terminal of RAB15 corresponding to a region with amino acids SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI

The Biotin antibody is a polyclonal antibody that specifically binds to biotin. It has a high affinity for biotin and can be used in various applications such as immunohistochemistry, Western blotting, and ELISA. This antibody is commonly used in life sciences research to detect and visualize biotinylated molecules or to amplify signals in assays. It can also be used in conjunction with streptavidin-conjugated enzymes or fluorochromes for detection purposes. The Biotin antibody is highly specific and sensitive, making it an essential tool for researchers working with biotinylation techniques or studying the role of biotin in biological processes.

His tag antibody was raised in rabbit using 6-His (HHHHHH) conjugated to KLH as the immunogen.

A4GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE

The Tyrosine Hydroxylase antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to target and detect tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter essential for brain function. This antibody is commonly used in immunoassays to study the expression and localization of tyrosine hydroxylase in various tissues and cell types.

ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET

LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids HLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPL

SLPI antibody was raised in rabbit using the N terminal of SLPI as the immunogen

The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.

The AKR1C1 antibody is a potent family kinase inhibitor that targets specific growth factors, such as glucagon and epidermal growth factor. It is a polyclonal antibody that has been developed for neutralizing the effects of these growth factors in various biological systems. The antibody is formulated with excipients to ensure stability and efficacy. It can be used in various life science applications, including research and diagnostics. Additionally, the AKR1C1 antibody can also target other proteins, such as β-catenin, chemokines, alpha-fetoprotein, and globulins. Its specificity and effectiveness make it an essential tool for studying protein-protein interactions and cellular signaling pathways.

PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE

Affinity purified Rabbit polyclonal TATDN1 antibody

SAMSN1 antibody was raised using the middle region of SAMSN1 corresponding to a region with amino acids DISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS

CREB5 antibody was raised in Rabbit using Human CREB5 as the immunogen

KCNK5 antibody was raised in Rabbit using Human KCNK5 as the immunogen

Rabbit polyclonal NUTF2 antibody

ATP6V1G2 antibody was raised in rabbit using the middle region of ATP6V1G2 as the immunogen

Affinity purified Rabbit polyclonal NDUFA10 antibody

AK1 antibody was raised in Rabbit using Human AK1 as the immunogen

Rabbit polyclonal RPS21 antibody

Rabbit polyclonal PPP1R1B antibody

The HDAC2 antibody is a highly specific and potent cytotoxic agent that targets HDAC2, an enzyme involved in gene regulation. This antibody has been extensively studied in various research fields, including Life Sciences and drug development.

The PTGFRN antibody is a highly specialized polyclonal antibody that targets the PTGFRN protein. This protein is involved in various cellular processes, including signal transduction and gene expression regulation. The PTGFRN antibody specifically recognizes and binds to the p38 mitogen-activated protein (MAP) kinase and nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling pathways.

Affinity purified Rabbit polyclonal TTC11 antibody

RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNN

TSH beta antibody was raised against Human TSH (intact).

Donkey anti-rat IgG (H + L) (FITC) was raised in donkey using Rat IgG (H&L) as the immunogen.

The SATB1 antibody is a highly specialized growth factor that belongs to the class of antibodies. It is a monoclonal antibody that has cytotoxic and antiangiogenic properties, making it an effective proliferation inhibitor. In the field of Life Sciences, this antibody is widely used for its ability to neutralize various growth factors, including epidermal growth factor (EGF), transforming growth factor-beta (TGF-beta), and chemokines. The SATB1 antibody specifically targets low-molecular-weight endothelial growth factors, inhibiting their activity and preventing angiogenesis. This monoclonal antibody is a valuable tool in research and clinical applications related to cancer, inflammation, and other diseases involving abnormal cell growth.

Benzodiazepine antibody was raised in mouse using benzodiazepine as the immunogen.

Rabbit polyclonal WBSCR17 antibody

The MAOA antibody is a highly specific and potent inhibitor of the enzyme monoamine oxidase A (MAOA). This antibody binds to the active site of MAOA, preventing its enzymatic activity. MAOA plays a crucial role in the metabolism of histamine, serotonin, and other neurotransmitters, making it an important target for therapeutic interventions. The MAOA antibody has been extensively studied in various research areas, including neuroscience, oncology, and immunology.

Rabbit polyclonal FRS2 antibody

Mouse monoclonal PDE6G antibody

Rabbit polyclonal PSMD2 antibody

Mouse monoclonal GORASP1 antibody

The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its potency has been demonstrated through patch-clamp techniques on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

H2AFY2 antibody was raised using the middle region of H2AFY2 corresponding to a region with amino acids KKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLV

The Notch 1 antibody is a substance used in Life Sciences research and development. It is specifically designed to target and bind to the Notch 1 antigen, which plays a crucial role in cell signaling and development. By inhibiting the activity of Notch 1, this antibody can help researchers gain a better understanding of various biological processes.

The STK4 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets mycoplasma genitalium and has been shown to neutralize its effects. This antibody can be used in various applications, including the study of epidermal growth factor and collagen. Additionally, it has been found to have inhibitory properties against other growth factors such as TGF-beta. The STK4 antibody is also cytotoxic and can induce lysis in targeted cells. Researchers can use this antibody to investigate the role of specific proteins or pathways in cellular processes and disease development.

The NMDAR1 antibody is a monoclonal antibody that targets the N-methyl-D-aspartate receptor subtype 1 (NMDAR1). This receptor is involved in various physiological processes, including synaptic plasticity and learning. The NMDAR1 antibody has been shown to inhibit the activation of NMDAR1 and reduce microvessel density in tumors by blocking the binding of growth factors to their receptors. It has also been demonstrated to modulate the expression of histidine, epidermal growth factor, and steroid receptors in granulosa cells. In addition, this antibody can activate e-cadherin and β-catenin signaling pathways, which are important for cell adhesion and migration. Overall, the NMDAR1 antibody offers promising applications in life sciences research and provides valuable insights into cellular mechanisms related to growth and development.

Rabbit polyclonal NOP2 antibody

GLUD1 antibody was raised in Rabbit using Human GLUD1 as the immunogen

Rabbit polyclonal NUDT19 antibody

Rabbit polyclonal PPP1R1B antibody (Thr75)

The TFF1 antibody is a highly specific monoclonal antibody that targets the glutamate receptor. It has cytotoxic properties and can effectively neutralize autoantibodies in the body. The TFF1 antibody is designed to specifically bind to reactive antibodies, preventing them from causing harm to healthy cells. Additionally, this antibody has been shown to inhibit the activity of β-catenin, a protein involved in cell adhesion and signaling pathways.

The LIMK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the LIMK1 protein, which plays a crucial role in cellular processes such as cell migration and cytoskeletal organization. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and flow cytometry.

Rabbit polyclonal COX6C antibody

FCAR antibody was raised in Rabbit using Human FCAR as the immunogen

The XRCC5 antibody is a highly specialized polyclonal antibody that targets the XRCC5 protein. This protein plays a crucial role in DNA repair and recombination processes. The XRCC5 antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry. It has been shown to have antiviral properties by inhibiting the replication of certain viruses. Additionally, this antibody has been found to interact with dopamine receptors and glycoproteins, suggesting its potential involvement in neurotransmission and cell signaling pathways. Furthermore, studies have demonstrated that the XRCC5 antibody can detect the presence of antiphospholipid antibodies in human serum samples, making it a valuable tool for diagnosing autoimmune disorders. Its ability to modulate hormone peptide activity and interfere with the function of certain inhibitors and inhibitory factors further highlights its versatility in research settings.

Affinity purified Rabbit polyclonal RAPGEF5 antibody

BCL2L10 antibody was raised in Rabbit using Human BCL2L10 as the immunogen

Affinity purified Rabbit polyclonal TMEM59 antibody

The INPP5B antibody is a highly effective substance used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is widely used as a test substance in various research applications. This antibody specifically targets INPP5B, an enzyme involved in the metabolism of inositol phosphates. By inhibiting the activity of INPP5B, this antibody can modulate cellular signaling pathways and provide valuable insights into various cellular processes.

Rabbit polyclonal SMAD2 antibody (Ser467)

FOXM1 antibody was raised in rabbit using the middle region of FOXM1 as the immunogen

The CYP2E1 antibody is a monoclonal antibody used in life sciences research. It specifically targets the CYP2E1 enzyme, which is primarily found in the liver microsomes. This antibody has been widely used to study the role of CYP2E1 in various physiological processes, including drug metabolism, alcohol metabolism, and oxidative stress. It can be used for immunohistochemistry, western blotting, and other molecular biology techniques to detect and quantify the expression levels of CYP2E1 in different tissues and cell types. The CYP2E1 antibody is highly specific and sensitive, making it an essential tool for researchers studying the function and regulation of this important enzyme.

The SERCA2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the nuclear protein SERCA2, which is involved in the regulation of calcium ion transport. This antibody is commonly used to study the role of SERCA2 in various biological processes such as glucose-6-phosphate metabolism and tyrosine phosphorylation. Additionally, it has been utilized in the detection and quantification of autoantibodies, including antiphospholipid antibodies, which are associated with autoimmune disorders. The SERCA2 antibody can also be used as an anti-connexin agent to block gap junction communication and investigate its impact on cellular signaling pathways. Furthermore, this antibody has potential applications as an anticoagulant due to its ability to inhibit collagen-induced platelet aggregation. With its high specificity and versatility, the SERCA2 antibody is a valuable tool for researchers in multiple fields of study.

The AKR1B1 antibody is a glycoprotein that targets a specific human protein. It is widely used in the field of Life Sciences for its antiviral properties. This antibody is commonly used in immunoassays, where it plays a crucial role in detecting and quantifying the presence of the target protein. The AKR1B1 antibody can also be used as a tool in various research applications, such as studying fatty acid metabolism or investigating the role of progesterone in cellular processes. It is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs. The AKR1B1 antibody has been extensively tested and validated, ensuring reliable and accurate results in experiments. Whether you are conducting basic research or developing diagnostic assays, this antibody is an essential tool for your scientific endeavors.

Rabbit polyclonal HOXA7 antibody

Mouse thymocyte antibody was raised in rabbit using RBC-free murine thymocytes as the immunogen.

Rabbit polyclonal PDCL2 antibody

Rabbit polyclonal APT2 antibody (FITC)

Rabbit polyclonal COL4A1 antibody (FITC)

The PRUNE antibody is a monoclonal antibody that specifically targets the cysteine-rich protein known as PRUNE. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. PRUNE is a multifunctional protein that acts as a growth factor and glycoprotein, playing a crucial role in cellular processes.

Affinity purified Rabbit polyclonal FHL5 antibody

Affinity purified Rabbit polyclonal LETM1 antibody

CXCL12 antibody was raised in rabbit using the middle region of CXCL12 as the immunogen

The Caspase 7 antibody is a highly specialized nuclear receptor that plays a crucial role in apoptosis, the process of programmed cell death. This antibody specifically targets and binds to the HER2 protein, making it an effective anti-HER2 antibody. It belongs to the group of polyclonal antibodies, which are derived from multiple B-cell clones and can recognize different epitopes on the target protein.

The HSF2 antibody is a biomolecule widely used in Life Sciences research. It plays a crucial role in various applications such as electrophoresis, neutralizing specific proteins or molecules, and measuring microvessel density. This antibody has shown promising results in inhibiting the activity of erythropoietin, a growth factor involved in red blood cell production. Additionally, it has been used as an immunosuppressant and is commonly employed in immunoassays to detect specific targets. The HSF2 antibody exhibits cytotoxic properties and can be utilized as a tool for targeted therapy. It is available as a monoclonal antibody and can be combined with other colloidal inhibitors for enhanced efficacy. Researchers also explore the potential of this antibody as a natriuretic agent due to its ability to regulate fluid balance within the body.

The TYK2 antibody is a powerful tool used in the field of Life Sciences. It is a multidrug that targets the nuclear chemokine receptors and acts on actin filaments. This antibody has been extensively studied and has shown efficacy in various research areas.

GANP antibody is a monoclonal antibody that targets the GANP protein. This protein plays a crucial role in various cellular processes, including histidine metabolism, epidermal growth factor signaling, and β-catenin regulation. By specifically binding to GANP, this antibody inhibits its function and disrupts the normal cellular processes associated with it.

Affinity purified Rabbit polyclonal Apoptosis enhancing nuclease antibody

Affinity purified Rabbit polyclonal Glycine Receptor alpha 2 antibody

Mouse monoclonal Cytokeratin AE1 antibody

The FYN antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the activated form of the FYN protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to effectively inhibit the activity of FYN, making it an invaluable tool for researchers studying signal transduction pathways and cellular signaling.

Rabbit polyclonal BRCA1 antibody (HRP)

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.