Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
ILK antibody
The ILK antibody is a powerful tool used in scientific research and diagnostics. This monoclonal antibody specifically targets ILK (Integrin-Linked Kinase), a key protein involved in various cellular processes. It plays a crucial role in cell adhesion, migration, proliferation, and survival.
GJB2 antibody
GJB2 antibody was raised using the N terminal of GJB2 corresponding to a region with amino acids STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
MTHFD2 antibody
MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE
TNFSF13 antibody
TNFSF13 antibody was raised in rabbit using the middle region of TNFSF13 as the immunogen
COL1A1 antibody
The COL1A1 antibody is a polyclonal antibody that specifically targets collagen type I alpha 1 chain. It can be used in various research applications, including immunohistochemistry and western blotting. This antibody plays a crucial role in the study of lipoprotein lipase and its interaction with collagen. Additionally, it has been shown to have potential therapeutic applications in diseases such as trastuzumab-resistant breast cancer.
TGFR3 antibody
TGFR3 antibody is a polyclonal antibody that specifically targets the TGFR3 protein. It is commonly used in life sciences research to study the role of TGFR3 in various cellular processes. This antibody can be used for applications such as immunohistochemistry, western blotting, and flow cytometry.
Amylase antibody
Amylase antibody is a polyclonal antibody that specifically targets and binds to amylase, an enzyme responsible for the breakdown of starch into sugars. This antibody has been widely used in life sciences research to study the role of amylase in various biological processes.
Chicken anti Mouse IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Degré de pureté :Min. 95%SNRPB antibody
SNRPB antibody was raised using the N terminal of SNRPB corresponding to a region with amino acids DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG
PPP1R13B antibody
PPP1R13B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNADegré de pureté :Min. 95%Hemocyanin antibody
The Hemocyanin antibody is a valuable product in the field of Life Sciences. This antibody specifically targets fatty acids and is widely used in research involving Antibodies. It acts as a family kinase inhibitor, preventing the activation of kinases that play a crucial role in cell signaling pathways. Additionally, this antibody has been shown to interact with collagen, epidermal growth factor, and interleukin-6, making it an essential tool for studying the effects of these molecules on various biological processes.CLPP antibody
The CLPP antibody is a monoclonal antibody that specifically targets the CLPP protein. This glycoprotein plays a crucial role in various biological processes and has been extensively studied in the field of Life Sciences. The CLPP antibody recognizes and binds to the histidine residues on the CLPP protein, allowing for accurate detection and analysis.
ZNF420 antibody
ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN
NNMT antibody
NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
Goat anti Rat IgG (H + L) (HRP)
Goat anti-rat IgG (H+L) (HRP) was raised in goat using rat IgG whole molecule as the immunogen.Degré de pureté :Min. 95%Goat anti Mouse IgG + IgM (H + L)
Goat anti-mouse IgG/IgM (H+L) was raised in goat using murine IgG and IgM whole molecules as the immunogen.
Degré de pureté :Min. 95%CD117 antibody (Spectral Red)
CD117 antibody (CY5) was raised in rat using murine CD117/c-Kit as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molTroponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 26-35 of cTnI as the immunogen.
p63 antibody
The p63 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the amino-terminal region of the p63 protein, which plays a crucial role in the development and function of cardiomyocytes. This antibody has been shown to be effective in detecting and quantifying levels of p63 in various biological samples, including pleural fluid and tissue samples.
CD55 antibody
The CD55 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize glutamate, a key molecule involved in various cellular processes. This antibody has been extensively studied for its potential therapeutic applications, particularly in the treatment of HER2-positive cancers.
PARD6A antibody
PARD6A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH
Factor XII antibody
Factor XII antibody was raised in goat using human Factor XII purified from plasma as the immunogen.
BHMT antibody
The BHMT antibody is a monoclonal antibody that is reactive against amyloid plaque. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets β-catenin, which is an important protein involved in cellular signaling pathways. It has been shown to be activated in various diseases, including cancer. The BHMT antibody can also be used to detect and measure levels of glial fibrillary acidic protein (GFAP), which is a marker for astrocytes. Additionally, this antibody has been used in studies investigating the role of dopamine and other neurotransmitters in neurological disorders. It can be utilized as a tool for inhibiting protein kinase activity and studying its effects on cellular processes. The BHMT antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. It can be purchased in colloidal form for ease of use and accurate results.
TNFR1 antibody
TNFR1 antibody is a highly specific antibody that targets the tumor necrosis factor receptor 1 (TNFR1). It binds to TNFR1 and inhibits its activity, thereby blocking the binding of TNF-α and preventing downstream signaling pathways. This antibody has been extensively studied in various fields of Life Sciences, including cancer research, immunology, and molecular biology.
OTC antibody
OTC antibody was raised using the N terminal of OTC corresponding to a region with amino acids AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD
PGCP antibody
The PGCP antibody is a synthetic polyclonal antibody that specifically targets glutamate. It can be used in Life Sciences research for various applications, including staining and detection of glutamate in cells and tissues. The antibody solution contains streptavidin-conjugated alkaline phosphatase, which allows for chromogenic or fluorescent detection methods. The PGCP antibody has high affinity and specificity towards glutamate, making it a valuable tool for studying the role of this neurotransmitter in biological processes. Its conjugation to alkaline phosphatase enables easy visualization and quantification of glutamate levels in samples using chromogenic or fluorescent molecules.
IL17A antibody
IL17A antibody is a monoclonal antibody that specifically targets and inhibits the activity of IL-17A, a cytokine involved in immune responses and inflammation. IL-17A plays a crucial role in various autoimmune diseases and inflammatory conditions. The IL17A antibody binds to IL-17A receptors, preventing the interaction between IL-17A and its receptors. This inhibition leads to a reduction in the production of pro-inflammatory molecules and cytokines, thereby suppressing the immune response. The IL17A antibody is widely used in immunoassays to detect and quantify IL-17A levels in biological samples. It is also utilized in research studies to investigate the role of IL-17A in different diseases and as a potential therapeutic target for treating inflammatory disorders. With its high specificity and potency, the IL17A antibody provides researchers with valuable tools for understanding the complex mechanisms underlying immune system dysregulation.
AFP antibody
The AFP antibody is a highly specialized monoclonal antibody that has been developed for various applications in the field of biomedical research. This antibody specifically targets and binds to alpha-fetoprotein (AFP), a human protein that is commonly found in the serum of individuals with certain medical conditions.
SH3RF1 antibody
SH3RF1 antibody was raised using the middle region of SH3RF1 corresponding to a region with amino acids LLKLLSGASTKRKPRVSPPASPTLEVELGSAELPLQGAVGPELPPGGGHG
PYCR2 antibody
PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS
Ly108 antibody
The Ly108 antibody is a cytotoxic antibody that belongs to the class of monoclonal antibodies. It has been shown to target and destroy cells expressing Ly108, making it an effective treatment for certain diseases. This antibody has the ability to bind to multiple targets, including autoantibodies, growth factors such as interleukin-6 and interferon, fibronectin, collagen, glycoproteins, and erythropoietin. In the field of life sciences, the Ly108 antibody is widely used for research purposes and in the development of therapeutic drugs. It has also been used in combination with other monoclonal antibodies like trastuzumab to enhance their efficacy. With its versatile targeting capabilities, the Ly108 antibody offers promising potential for various applications in medical and scientific fields.Factor X antibody (HRP)
Factor X antibody (HRP) was raised in goat using human Factor X purified from plasma as the immunogen.
AGT antibody
AGT antibody was raised using a synthetic peptide corresponding to a region with amino acids IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ
Degré de pureté :Min. 95%TRMT5 antibody
TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT
HSV1 + HSV2 antibody (biotin)
HSV1/HSV2 antibody (biotin) was raised in rabbit using Strain F as the immunogen.PPIL2 antibody
PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ
PLD3 antibody
PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
Degré de pureté :Min. 95%H+K+ ATPase antibody
H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.
Goat anti Mouse IgG (H + L)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Degré de pureté :Min. 95%STK11 antibody
STK11 antibody was raised in rabbit using the C terminal of STK11 as the immunogen
Degré de pureté :Min. 95%SLC18A2 antibody
The SLC18A2 antibody is a monoclonal antibody that specifically targets the protein encoded by the SLC18A2 gene. This gene encodes a glycoprotein that functions as a vesicular monoamine transporter, responsible for transporting neurotransmitters such as dopamine, norepinephrine, and serotonin into synaptic vesicles. The SLC18A2 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.Methylprednisolone antibody
The Methylprednisolone antibody is a monoclonal antibody that falls under the category of Life Sciences. This hormone peptide antibody specifically targets and binds to methylprednisolone, a steroid hormone. It has a glycan structure that plays a crucial role in neutralizing the effects of methylprednisolone.Degré de pureté :Min. 95%ZHX2 antibody
The ZHX2 antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to neutralize lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody can be used as a research tool to study the function and regulation of lipoprotein lipase in various biological systems.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
