Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
Annexin A5 antibody
The Annexin A5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of annexin, a protein involved in various cellular processes such as apoptosis and inflammation. This antibody specifically binds to annexin, allowing researchers to study its role in different biological systems.
ARAF antibody
The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.
Tetraspanin 32 antibody
Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD
C-peptide antibody
The C-peptide antibody is a monoclonal antibody that is used for various applications in medical research and diagnostics. It is designed to specifically target and bind to the C-peptide, a peptide released during the processing of proinsulin into insulin. This antibody has been extensively characterized and validated for its high specificity and sensitivity.
PPIE antibody
PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP
SSRP1 antibody
The SSRP1 antibody is a powerful tool in Life Sciences research. It specifically targets and binds to tumor necrosis factor-alpha (TNF-α) and imatinib, both of which are growth factors involved in various cellular processes. By binding to these proteins, the SSRP1 antibody can inhibit their activity and disrupt signaling pathways that promote cell growth and survival.
alpha Actin antibody
The alpha Actin antibody is a powerful tool used in Life Sciences research. It belongs to the category of antibodies, specifically polyclonal and monoclonal antibodies. This antibody is known for its neutralizing properties against fibronectin, chemokines, growth factors, and collagen. It has been extensively studied and proven to be highly specific in detecting and targeting alpha Actin, an important protein involved in cell structure and movement. The alpha Actin antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the expression and localization of alpha Actin in different tissues and cell types. Researchers rely on this specific antibody to gain insights into cellular processes, signaling pathways, and disease mechanisms related to actin dynamics.
Ephrin A1 antibody
The Ephrin A1 antibody is a highly specialized antibody used in the field of Life Sciences. It is particularly effective against HER2, a protein that plays a crucial role in various cellular processes. This antibody has been extensively tested and has shown high affinity towards HER2, making it an ideal tool for research and diagnostic purposes.
Galectin 3 antibody
Galectin 3 antibody was raised in mouse using full length recombinant human galectin-3 as the immunogen.
Lysozyme antibody
The Lysozyme antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and detects lysozyme, an enzyme found in various biological systems. This antibody can be used in a wide range of applications, including androgen assays, immunohistochemistry, Western blotting, and ELISA.
SREBF2 antibody
SREBF2 antibody was raised in rabbit using the middle region of SREBF2 as the immunogen
IFITM1 antibody
The IFITM1 antibody is a chemokine that plays a crucial role in immune response modulation. It is a polyclonal antibody that specifically targets the proprotein encoded by the IFITM1 gene. This antibody can be used for various applications in life sciences, including research and diagnostic purposes.
GLUT4 antibody
The GLUT4 antibody is a polyclonal antibody used in the life sciences field. It specifically targets binding proteins involved in the regulation of glucose transport. This antibody has been extensively tested and validated for its specificity and sensitivity. It has been shown to effectively detect GLUT4 expression in various tissues and cell types.
APCS antibody
APCS antibody was raised using the N terminal of APCS corresponding to a region with amino acids NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
PFK antibody
The PFK antibody is a highly specialized polymerase enzyme that acts as a neutralizing agent. It is a monoclonal antibody specifically designed to target collagen and inhibit its activity. This antibody has shown great potential in the field of Life Sciences, particularly in research related to TGF-beta1, albumin, phosphatase, growth factors, interferon, glutamate, and dopamine. Its unique mechanism of action makes it an invaluable tool for studying various biological processes and pathways. Whether you're conducting experiments or exploring new therapeutic avenues, the PFK antibody is sure to be an asset in your scientific endeavors.
AURKA antibody
The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.
GCNT3 antibody
GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
TRIM32 antibody
The TRIM32 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to TRIM32, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in various applications.
FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
