Anticorps primaires

ACP6 antibody was raised in Rabbit using Human ACP6 as the immunogen

HECTD2 antibody was raised using the C terminal of HECTD2 corresponding to a region with amino acids TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET

Rabbit polyclonal PSMB1 antibody

The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.

CPSF1 antibody was raised in Rabbit using Human CPSF1 as the immunogen

ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH

Rabbit polyclonal NUDT12 antibody

The ARC antibody is a highly specialized antibody that has numerous characteristics and applications in the field of Life Sciences. It is an autoantibody that specifically targets adenine, a crucial molecule involved in various biological processes. The ARC antibody has been extensively studied for its ability to inhibit the growth factor β-catenin, which plays a crucial role in cell proliferation and differentiation.

BRSK2 antibody was raised in Rabbit using Human BRSK2 as the immunogen

TSH beta antibody was raised against Human TSH (intact).

Rabbit polyclonal STXBP2 antibody

PSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN

Rabbit polyclonal BRCA1 antibody (HRP)

Affinity purified Rabbit polyclonal IRAK3 antibody

The ATF3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing (TNF) monoclonal antibodies. It is commonly used in Life Sciences research as a tool to study the function and expression of ATF3, a transcription factor involved in cellular stress response. This monoclonal antibody specifically binds to human mitochondrial ATF3 and has been widely used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. The ATF3 antibody recognizes an antigen located on the surface of cells and can be utilized for both diagnostic and therapeutic purposes. With its high specificity and cytotoxic properties, this glycoprotein is an essential tool for researchers working in the field of molecular biology and immunology. Additionally, polyclonal antibodies targeting ATF3 are also available for those who require a broader range of reactivity.

Rabbit polyclonal PA2G4 antibody

AKR1B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

CHIT1 antibody was raised in Mouse using a purified recombinant fragment of CHIT1(aa22-137) expressed in E. coli as the immunogen.

The CD4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting coagulation factors and other active agents involved in various biological processes. This monoclonal antibody specifically binds to nuclear antigens, making it an effective tool for research and diagnostic purposes.

Rabbit polyclonal TERF2IP antibody

Affinity purified Rabbit polyclonal RIC8A antibody

Transglutaminase 2 antibody is a highly specialized monoclonal antibody that targets the transglutaminase 2 protein. This protein plays a crucial role in various cellular processes, including apoptosis, cell adhesion, and signal transduction. The antibody specifically recognizes and binds to transglutaminase 2, inhibiting its enzymatic activity.

GJC3 antibody was raised in rabbit using the middle region of GJC3 as the immunogen

EGFL8 antibody was raised using the C terminal of EGFL8 corresponding to a region with amino acids QAGAWVRAVLPVPPEELQPEQVAELWGRGDRIESLSDQVLLLEERLGACS

NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF

H2AFZ antibody was raised in Rabbit using Human H2AFZ as the immunogen

The SLC22A17 antibody is a powerful tool used in Life Sciences research for the detection and analysis of cxcl13, a nuclear antigen. This polyclonal antibody has been extensively tested and validated for various applications, including immunohistochemistry and DNA-binding protein studies. It specifically recognizes and binds to the surface glycoprotein expressed by SLC22A17, forming a specific complex that can be visualized using techniques such as impedance spectroscopy. With its high specificity and sensitivity, this monoclonal antibody is an essential component in any research project requiring the detection of SLC22A17. Trust in its reliability and accuracy to advance your scientific endeavors.

The PYK2 antibody is a highly specific monoclonal antibody that targets PYK2, a tyrosine kinase protein involved in various cellular processes. This antibody has been extensively tested and validated for its ability to neutralize the activity of PYK2, making it an invaluable tool for researchers studying signal transduction pathways and cell signaling mechanisms. The PYK2 antibody can be used in a variety of applications, including Western blotting, immunoprecipitation, immunofluorescence, and flow cytometry. It is available as both a purified monoclonal antibody and as part of a kit that includes all the necessary reagents for successful experiments. With its high specificity and sensitivity, the PYK2 antibody is an essential tool for any researcher working with PYK2-related studies.

Rabbit polyclonal NFkB antibody (Regulatory Factor)

Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ

COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY

CD45.1 antibody (Spectral Red) was raised in mouse using CD45.1 as the immunogen.

Rabbit polyclonal NRBP2 antibody

Rabbit polyclonal TCF7 antibody

Rabbit polyclonal TNFRSF13B antibody

BCL2L10 antibody was raised in Rabbit using Human BCL2L10 as the immunogen

COL6A2 antibody was raised in Rabbit using Human COL6A2 as the immunogen

Mouse monoclonal SPR antibody

CD19 antibody (Spectral Red) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.