Anticorps primaires

Mouse monoclonal MPP3 antibody

Rabbit polyclonal PPT1 antibody

KRT17 antibody was raised in Rabbit using Human KRT17 as the immunogen

The VANGL1 antibody is a highly specialized monoclonal antibody that targets the VANGL1 protein. This protein is primarily found in the apical membrane of cells and plays a crucial role in various biological processes. The VANGL1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to epidermal growth factor signaling, tyrosine phosphorylation, human folate transport, collagen synthesis, and anti-CD20 therapy.

The PRKACB antibody is a highly specific antibody that targets the protein kinase A catalytic subunit beta (PRKACB). This antibody is derived from a vaccine strain and has been extensively tested for its antigen specificity. It has shown high affinity and selectivity for PRKACB, making it an ideal tool for studying the function and regulation of this protein.

Goat anti-human IgG (Alk Phos) was raised in goat using human IgG F(c) fragment as the immunogen.

NR2F1 antibody was raised using the C terminal of NR2F1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP

NIP7 antibody was raised in Rabbit using Human NIP7 as the immunogen

Mouse monoclonal PYCRL antibody

Rabbit polyclonal ARL2 antibody (FITC)

The EEF2 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It binds to and detects the eukaryotic elongation factor 2 (EEF2) protein, which plays a crucial role in protein synthesis. This antibody has been extensively validated for various applications, including immunohistochemistry, western blotting, and flow cytometry.

Rabbit polyclonal IKK gamma antibody

MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.

Rabbit polyclonal RIOK3 antibody

MINA antibody was raised in Rabbit using Human MINA as the immunogen

LSS antibody was raised in Rabbit using Human LSS as the immunogen

The PSAP antibody is a growth factor antigen that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences, particularly in antibody research. The PSAP antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.

The HES2 antibody is a polyclonal antibody that specifically targets the serum albumin protein. It has cytotoxic properties and is widely used in Life Sciences research. The HES2 antibody has been shown to interact with various proteins, including angptl3, e-cadherin, taxol, β-catenin, and osteopontin. It is commonly used in experiments involving hybridization and activated human serum. This antibody is highly effective in detecting and analyzing specific proteins in biological samples, making it an essential tool for researchers in various fields.

The Caspase 9 antibody is a polyclonal antibody that specifically targets the caspase-9 protein. This antibody has been shown to have neutralizing properties and can effectively inhibit the activity of caspase-9. Caspase-9 plays a crucial role in apoptosis, or programmed cell death, by initiating the cascade of events that lead to cell death. By targeting caspase-9, this antibody can help regulate cell growth and survival.

TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.

LOC344065 antibody was raised in rabbit using the middle region of LOC344065 as the immunogen

ART3 antibody was raised in Rabbit using Human ART3 as the immunogen

Lamin Type A and C antibody was raised in mouse using Nuclear pore complex-lamina fraction of bovine liver as the immunogen.

CYP2A13 antibody was raised using the C terminal of CYP2A13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF

Rabbit polyclonal PLDN antibody

LIAS antibody was raised using the N terminal of LIAS corresponding to a region with amino acids LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG

The PARP2 antibody is a cytotoxic monoclonal antibody used in Life Sciences research. It is designed to target and bind to the PARP2 protein, which plays a crucial role in DNA repair and cell survival. This antibody can be immobilized on an electrode or used in various assays to study the interaction between PARP2 and other molecules.

Purified Polyclonal BAF170 antibody

The CYP1A1 antibody is a highly specific antibody that targets the cytochrome P450 1A1 enzyme. This enzyme plays a crucial role in the metabolism of various drugs and toxins in the body. The CYP1A1 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assay (ELISA). It has been extensively validated for its specificity and sensitivity.

GNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR

Rabbit polyclonal CKS1 antibody

Rabbit polyclonal COX5A antibody (FITC)

CD203c antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to DNA binding proteins that play a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in glycosylation studies, where it helps researchers understand the role of glycosylation in protein function and regulation.

The PSA antibody is a monoclonal antibody that specifically targets the prostate-specific antigen (PSA) found in human serum. It is designed to bind to PSA and inhibit its activity. This antibody is produced using histidine-tagged recombinant proteins and has been shown to effectively detect PSA levels in various diagnostic tests, such as enzyme-linked immunosorbent assays (ELISA) or immunohistochemistry.

CD45.1 antibody (Spectral Red) was raised in mouse using CD45.1 as the immunogen.

Rabbit polyclonal UNKL antibody

Rabbit polyclonal RNF168 antibody

Purified Rabbit polyclonal CBLN1 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.

Arginase 2 antibody was raised using the C terminal of ARG2 corresponding to a region with amino acids SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT

MLF1 antibody was raised in Rabbit using Human MLF1 as the immunogen

CD44 antibody (Spectral Red) was raised in mouse using chicken CD44 as the immunogen.