Anticorps primaires

Affinity purified Rabbit polyclonal UQCRC1 antibody

The Interferon gamma antibody is a monoclonal antibody that targets interferon gamma, a growth factor involved in immune response regulation. This antibody is widely used in Life Sciences research to study the functions and effects of interferon gamma. It can be used for various applications such as immunohistochemistry, flow cytometry, and enzyme-linked immunosorbent assays (ELISA). The Interferon gamma antibody specifically binds to interferon gamma and can be used to detect its presence in biological samples. It has high specificity and sensitivity, making it an essential tool for researchers studying the role of interferon gamma in various biological processes.

CKAP2 antibody was raised in rabbit using the C terminal of CKAP2 as the immunogen

LIPH antibody was raised in rabbit using the C terminal of LIPH as the immunogen

Rabbit polyclonal TLR2 antibody (Middle Region)

The HIPK2 antibody is a highly specialized tool used in Life Sciences research. It is a Polyclonal Antibody that is designed for the ultrasensitive detection and neutralization of clostridial neurotoxins. The antibody can be immobilized on a carbon electrode, allowing for electrochemical impedance spectroscopy to be performed. This technique enables researchers to accurately measure the presence and activity of the toxins in various samples.

ACTA1 antibody was raised in rabbit using the N terminal of ACTA1 as the immunogen

The DKK3 antibody is a polyclonal antibody that specifically targets the glycoprotein DKK3. It is commonly used in life sciences research to study the role of DKK3 in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit cytotoxic effects induced by insulin. Additionally, it has been found to possess anticoagulant activity and can bind to phospholipids, making it useful for studying antiphospholipid antibodies. The DKK3 antibody is a valuable tool for researchers investigating the function and therapeutic potential of DKK3 in different contexts.

The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.

Rabbit polyclonal ALAS1 antibody raised against the N terminal of ALAS1

Affinity purified Rabbit polyclonal G-Catenin antibody

The C1R antibody is a highly specialized protein that plays a crucial role in various life sciences applications. This antibody is specifically designed to target and neutralize the activity of certain proteins, such as growth factors and autoantibodies, which are involved in various biological processes.

KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

The ZO1 antibody is a highly effective monoclonal antibody that specifically targets CD33, a cell surface protein. This antibody is widely used in the field of life sciences for various applications. It has been shown to inhibit the growth of cancer cells, such as MCF-7 breast cancer cells, by blocking the action of growth factors and interfering with cell signaling pathways. Additionally, the ZO1 antibody has been used in research involving mesenchymal stem cells to study their differentiation potential and therapeutic applications. Furthermore, this antibody can be utilized in immunohistochemistry and western blotting assays to detect and quantify specific proteins of interest. With its exceptional specificity and sensitivity, the ZO1 antibody is an invaluable tool for scientists and researchers in their quest for new discoveries in the field of molecular biology.

The Prolactin Receptor antibody is a growth factor that belongs to the class of monoclonal antibodies. It has neutralizing properties and can effectively inhibit the activity of prolactin, a hormone involved in lactation and reproductive functions. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.

MYO7B antibody was raised in Rabbit using Human MYO7B as the immunogen

IBSP antibody was raised using a synthetic peptide corresponding to a region with amino acids SATTLGYGEDATPGTGYTGLAAIQLPKKAGDITNKATKEKESDEEEEEEE

The N Cadherin antibody is a trifunctional antibody that has various applications in the field of Life Sciences. It can be used for research purposes, such as studying growth factors and their interactions with human serum. This antibody is commonly used in laboratory settings and can be used in experiments involving electrodes and other scientific equipment.

GCLM antibody was raised in Rabbit using Human GCLM as the immunogen

The K2 antibody is a highly effective nucleotide molecule that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This anti-her2 antibody-drug conjugate specifically binds to the HER2 receptor, which is overexpressed in certain types of cancer cells. It works by inhibiting the epidermal growth factor signaling pathway, preventing the growth and proliferation of cancer cells.

RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA

Affinity purified Rabbit polyclonal Neuregulin 2 antibody

Affinity purified Mouse polyclonal XRCC1 antibody

Affinity purified Rabbit polyclonal HHIP antibody

CD19 antibody (Azide free) was raised in mouse using human CD19 as the immunogen.

Affinity purified Rabbit polyclonal BCLx antibody

The HBcAg antibody is a reactive antibody that is used in various applications in the field of life sciences. It is commonly used for its neutralizing properties against antiphospholipid antibodies and anti-HER2 antibodies. This polyclonal antibody has been extensively studied and has shown high specificity and affinity towards its target antigens.

The MCM3 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets MCM3, a protein biomarker involved in various cellular processes. This antibody can be used in immunoassay tests to detect and quantify MCM3 levels in samples, providing valuable insights into cell cycle regulation, DNA replication, and other essential biological functions.

ABHD14B antibody was raised in Rabbit using Human ABHD14B as the immunogen

NINJ2 antibody was raised in Rabbit using Human NINJ2 as the immunogen

Affinity purified Rabbit polyclonal PRPS2 antibody

The APP antibody is a powerful tool used in medical research and diagnostics. It specifically targets alpha-fetoprotein (AFP), which is an important biomarker for various diseases, including liver cancer. The APP antibody binds to amyloid plaques, which are abnormal protein deposits found in the brains of individuals with Alzheimer's disease. This antibody can also be used to study growth factors and their binding proteins, providing valuable insights into cellular processes and signaling pathways.

Affinity purified Rabbit polyclonal ENTPD6 antibody

Rabbit polyclonal RPS14 antibody (biotin)

RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP

Affinity purified Rabbit polyclonal Integrin alpha 2b antibody

Affinity purified Rabbit polyclonal KLRC4 antibody

CTSL2 antibody was raised in rabbit using the C terminal of CTSL2 as the immunogen

U1SNRNPBP antibody was raised using the N terminal of U1SNRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

CLYBL antibody was raised in Rabbit using Human CLYBL as the immunogen

SURF6 antibody was raised using the N terminal of SURF6 corresponding to a region with amino acids ICSHSAPEQQARTRAGKTQGSETAGPPKKKRKKTQKKFRKREEKAAEHKA

Affinity purified Rabbit polyclonal SPG7 antibody

CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL

Affinity purified Rabbit polyclonal Edc3 antibody

Affinity purified Rabbit polyclonal TXNDC3 antibody

ACSL3 antibody was raised in Rabbit using Human ACSL3 as the immunogen

CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS

CCNG1 antibody was raised in Rabbit using Human CCNG1 as the immunogen

OGDH antibody was raised using the N terminal of OGDH corresponding to a region with amino acids MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL

Rabbit polyclonal TGF beta 3 antibody

MAP2K2 antibody was raised using the N terminal of MAP2K2 corresponding to a region with amino acids LARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQK

The Parathyroid Hormone antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Parathyroid Hormone, allowing for precise detection and analysis. It has been extensively used in research studies to investigate the role of Parathyroid Hormone in various biological processes.

GALNTL2 antibody was raised in Rabbit using Human GALNTL2 as the immunogen

CD29 antibody is a polyclonal antibody that specifically targets the CD29 protein. This protein, also known as integrin beta-1, plays a crucial role in cell adhesion and migration. The CD29 antibody can be used in various research applications, including immunohistochemistry, flow cytometry, and Western blotting.

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.