Anticorps primaires

Rabbit polyclonal c-Rel antibody

This antibody reacts with heavy chains on human IgE (epsilon chain).

This antibody reacts with heavy chains on chicken IgG (IgY) and light chains on all chicken immunoglobulins.

The c-Jun antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the c-Jun protein. This protein plays a crucial role in various cellular processes, including fibronectin production, endothelial growth, and the regulation of interleukin-6 and epidermal growth factor.

The CD49b antibody is a specific antibody that is commonly used in immunoassays. It is designed to bind to the CD49b protein, which is found on the surface of various cell types including granulosa cells and mesenchymal stem cells. This antibody forms a disulfide bond with the CD49b protein, allowing for easy detection and quantification in biological samples.

The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.

The Ly6G antibody is a trifunctional monoclonal antibody that is widely used in the field of Life Sciences. It is commonly used for research purposes, specifically in the detection and analysis of various proteins and molecules. This antibody has phosphatase activity, making it a valuable tool for studying signal transduction pathways.

The PKR antibody is a highly specialized antibody used in Life Sciences research. It targets the protein kinase R (PKR), which plays a crucial role in cellular responses to viral infection and stress. This antibody is designed to specifically bind to PKR, allowing researchers to detect and study its activity in various biological samples.

Rabbit polyclonal PO5F1 antibody

IL2 antibody was raised in goat using highly pure recombinant human IL-2 as the immunogen.

The CD56 antibody is a monoclonal antibody that targets the CD56 glycoprotein. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The CD56 antibody specifically binds to CD56, which is expressed on natural killer cells, T cells, and some subsets of B cells. This binding activates protein kinase pathways, leading to cytotoxicity and apoptosis of target cells.

Met antibody is a polyclonal antibody that specifically targets the tyrosine kinase receptor known as c-Met. This antibody has neutralizing properties, meaning it can inhibit the activity of c-Met and its downstream signaling pathways. By binding to the protein complex formed by c-Met and its ligand, this antibody prevents the activation of various cellular processes involved in cell growth, survival, migration, and invasion.

ZNF488 antibody was raised in rabbit using the C terminal of ZNF488 as the immunogen

The EFNA4 antibody is a monoclonal antibody that targets autoantibodies against the EFNA4 protein. This protein is involved in various biological processes, including cell adhesion and migration. The EFNA4 antibody can be used in research and diagnostic applications to detect the presence of autoantibodies in human serum.

The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.

Transferrin antibody was raised in rabbit using rat transferrin as the immunogen.

Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.

Goat anti-cat IgG (H+L) was raised in goat using feline IgG whole molecule as the immunogen.

KBTBD10 antibody was raised in rabbit using the N terminal of KBTBD10 as the immunogen

The FAK antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody plays a crucial role in various biological processes, including fatty acid metabolism, insulin signaling, and fibrinogen binding. It is designed to specifically target and bind to focal adhesion kinase (FAK), an important protein involved in cell adhesion and migration.

The SCF antibody is a polyclonal antibody that has the ability to neutralize the activity of stem cell factor (SCF). Stem cell factor is an important growth factor involved in various cellular processes, including cell proliferation, differentiation, and survival. The SCF antibody can specifically bind to SCF and inhibit its function, preventing it from interacting with its receptor and initiating downstream signaling pathways.

Sheep polyclonal Hydroxyindole antibody

Rabbit polyclonal c-Cbl antibody

Affinity purified Rabbit polyclonal PIK3R4 antibody

This antibody reacts with heavy (gamma) chains on mouse IgG.

The SMAD3 antibody is a glycoprotein that acts as a growth factor and plays a crucial role in various cellular processes. It is a monoclonal antibody specifically designed to target SMAD3, which is involved in signal transduction pathways related to cell proliferation and differentiation. This antibody can be used for various applications such as immunohistochemistry, Western blotting, and flow cytometry.

SGK3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST

The p73 antibody is an essential tool in the field of life sciences. It specifically targets the epidermal growth factor and acts as an endonuclease, which is crucial for DNA repair and maintenance. The p73 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs.

Rabbit anti-sheep IgG (Alk Phos) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.

Goat anti-rat IgG (Fab'2) (FITC) was raised in goat using rat IgG F(c) fragment as the immunogen.

The p53 antibody is a highly specialized cytotoxic antibody that plays a crucial role in regulating cell growth and preventing tumor formation. It is known for its ability to target and neutralize antiphospholipid antibodies, which can lead to autoimmune disorders. Additionally, the p53 antibody has been shown to inhibit the activity of tyrosinase, an enzyme involved in melanin production, making it a potential treatment option for hyperpigmentation disorders.

Goat anti-mouse IgM (Fab'2) was raised in goat using murine IgM mu heavy chain as the immunogen.

CD3G antibody was raised in Rabbit using Human CD3G as the immunogen

Rabbit anti-chicken IgG was raised in rabbit using chicken IgG F(c) fragment as the immunogen.

Affinity purified Rabbit polyclonal beta A4 Crystallin antibody

Goat polyclonal Pseudomonas aeruginosa Exotoxin A antibody

Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.

Affinity purified Rabbit polyclonal DPRP1 antibody

Donkey anti Goat IgG (H + L) secondary antibody

The Syntaxin 4 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain oncogenic kinases. This antibody targets the binding proteins involved in the activation of these kinases, effectively blocking their activity and preventing the growth and proliferation of cancer cells.

Lipoprotein Lipase Monoclonal Antibody Biotin

This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.

CDC2L6 antibody was raised in Rabbit using Human CDC2L6 as the immunogen

Goat anti-mouse IgG/IgM (H+L) (Alk Phos) was raised in goat using murine IgG and IgM whole molecules as the immunogen.

Rabbit polyclonal TRKB antibody (Tyr705)

The Cystatin C antibody is a highly specialized antibody that is used in various applications in the field of Life Sciences. This polyclonal antibody specifically targets cystatin C, an anticoagulant protein that plays a crucial role in regulating protease activity. The Cystatin C antibody is widely used in research and diagnostic laboratories for the detection and quantification of cystatin C levels in biological samples.

The BDNF antibody is a neuroprotective agent that acts as a family kinase inhibitor. It targets the adiponectin receptor, which is involved in various cellular processes related to adipose tissue. This antibody is commonly used in life sciences research and is available as both polyclonal and monoclonal antibodies.

E. coli antibody was raised in goat using a mixture of E. coli serotypes as the immunogen.

The CD82 antibody is a powerful tool in the field of Life Sciences. It acts as a phosphatase that regulates various cellular processes by binding to specific proteins. This antibody has been shown to inhibit the production of interleukin-6, a pro-inflammatory cytokine involved in immune responses. Additionally, it can be used in antigen-antibody reactions to detect the presence of autoantibodies in patient samples.

Rabbit anti-bovine IgG (H+L) was raised in rabbit using bovine IgG whole molecule as the immunogen.

This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.

Sheep polyclonal 17b Estradiol 6 antibody

Rabbit polyclonal PDHA1 antibody

ZNF660 antibody was raised in rabbit using the C terminal of ZNF660 as the immunogen

Rabbit polyclonal RPS13 antibody (biotin)

The FZD6 antibody is a highly specialized monoclonal antibody that targets the insulin-like growth factor receptor (IGF-1R). It is designed to specifically bind to the IGF-1R and inhibit its activity. This antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic agent for various diseases, including cancer.

ANP32B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE

Goat anti-human IgG (Rhodamine) was raised in goat using human IgG heavy chain as the immunogen.

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.