Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75602 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
CBP antibody
The CBP antibody is a highly effective inhibitor that targets nuclear proteins. It is a monoclonal antibody that specifically recognizes and binds to acetylated biomolecules. This antibody has been extensively studied and proven to be cytotoxic against various types of cells. In Life Sciences research, the CBP antibody is commonly used in reaction solutions for experiments involving brain natriuretic peptide (BNP) and other related growth factors. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. The CBP antibody is supplied in buffered solutions, ensuring stability and maintaining its effectiveness throughout experiments.
RSRC2 antibody
RSRC2 antibody was raised using the C terminal of RSRC2 corresponding to a region with amino acids DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARSIL20R2 antibody
The IL20R2 antibody is a monoclonal antibody that is used in immunoassays to detect and quantify IL20R2 protein levels in human serum. It has been shown to have high specificity and sensitivity, making it an ideal tool for researchers studying the role of IL20R2 in various biological processes. This antibody can be used for applications such as Western blotting, ELISA, and immunohistochemistry. The IL20R2 antibody has also been used in molecular docking studies to understand its interaction with other molecules, providing valuable insights into its mechanism of action. With its ultrasensitive detection capabilities, this antibody is a valuable asset in the field of life sciences research.SLAIN1 antibody
SLAIN1 antibody was raised using the middle region of SLAIN1 corresponding to a region with amino acids RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPSEVI1 antibody
EVI1 antibody was raised in mouse using recombinant Human Ecotropic Viral Integration Site 1 (Evi1)
CAMLG antibody
CAMLG antibody was raised using the N terminal of CAMLG corresponding to a region with amino acids LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVTDRD9 antibody
TDRD9 antibody was raised using the middle region of TDRD9 corresponding to a region with amino acids AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPMEPHB6 antibody
EPHB6 antibody was raised in Mouse using a purified recombinant fragment of EPHB6 expressed in E. coli as the immunogen.TNNI3K antibody
TNNI3K antibody was raised using the middle region of TNNI3K corresponding to a region with amino acids PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY
C5ORF36 antibody
C5ORF36 antibody was raised using the N terminal Of C5Orf36 corresponding to a region with amino acids CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWDSheep RBC antibody (FITC)
Sheep RBC antibody (FITC) was raised in rabbit using ovine erythrocytes as the immunogen.BRDU antibody
The BRDU antibody is a growth factor that belongs to the class of glycoproteins. It acts by binding to specific proteins and promoting cell growth and division. This monoclonal antibody is highly specific and targets activated cells, making it a valuable tool in cancer research and diagnostics. The BRDU antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting. It is also cytotoxic, meaning it can selectively kill cells expressing the target protein. Additionally, this antibody has shown potential as an inhibitor of transmembrane conductance and has been implicated in the regulation of autoantibodies and chemokines. With its high specificity and versatility, the BRDU antibody is an essential tool for researchers studying cell growth and signaling pathways.AFP antibody
The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP), a growth factor found in adipose tissue. This antibody is widely used in life sciences research and has various applications in the field. It can be used as an inhibitor to study the function of AFP or as a tool to detect and measure AFP levels in biological samples.CR4 antibody
The CR4 antibody is a highly specialized monoclonal antibody that targets cholinergic growth factors, specifically choline acetyltransferase. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications.HBsAg antibody
The HBsAg antibody is a monoclonal antibody that specifically targets the alpha-fetoprotein (AFP) in human serum. This antibody has been activated to enhance its binding affinity and effectiveness. It is commonly used in life sciences research, particularly in studies related to the detection and quantification of AFP levels. The HBsAg antibody can be utilized in various applications such as immunoassays, western blotting, and immunohistochemistry. Its high specificity ensures accurate and reliable results. Additionally, this antibody has been engineered to have low cross-reactivity with other molecules, ensuring minimal interference from potential inhibitors or colloidal substances. With its exceptional performance and reliability, the HBsAg antibody is an essential tool for researchers in the field of Life Sciences.HERC6 antibody
HERC6 antibody was raised using the N terminal of HERC6 corresponding to a region with amino acids LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAHPON1 antibody
The PON1 antibody is a monoclonal antibody that has the ability to neutralize the activity of paraoxonase 1 (PON1). PON1 is an enzyme that plays a crucial role in protecting against oxidative stress and inflammation. By binding to PON1, this antibody can inhibit its activity and prevent the harmful effects associated with oxidative stress.HPX antibody
The HPX antibody is a neutralizing antibody that targets interferon and autoantibodies. It has been shown to have a high affinity for hemoglobin and growth factors. This polyclonal antibody is capable of binding to various proteins, including alpha-fetoprotein, c-myc, telomerase, collagen, and fibronectin. The HPX antibody can form complexes with these proteins, leading to their neutralization and inhibition of their biological activities. This antibody is widely used in research and diagnostic applications for its ability to detect and quantify specific proteins in various samples. Its versatility and specificity make it an essential tool for studying protein-protein interactions and understanding the role of specific proteins in various biological processes.RARG antibody
The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It acts as a growth factor and has been shown to inhibit hepatocyte growth. This antibody can be used for various applications, including research and therapeutic purposes. It has been found to have cytotoxic effects on cancer cells, such as MCF-7, and can also enhance the efficacy of other anticancer drugs. The RARG antibody binds specifically to RARG and modulates its activity, affecting downstream signaling pathways involved in cell proliferation, differentiation, and apoptosis. It has also been shown to interact with other proteins, such as fibronectin and lipoprotein lipase. This versatile antibody is a valuable tool for studying the role of RARG in various biological processes and may have potential applications in cancer treatment.CYB5R3 antibody
The CYB5R3 antibody is a polyclonal antibody that plays a crucial role in various cholinergic and growth factor-related processes in Life Sciences. It is commonly used in research to study the cytotoxic effects of certain compounds on liver microsomes and dopamine metabolism. The CYB5R3 antibody specifically targets and binds to activated CYB5R3, an enzyme involved in electron transfer reactions. This binding inhibits the enzymatic activity of CYB5R3, leading to a decrease in the production of reactive oxygen species and neuroprotective effects. Additionally, this antibody has been shown to inhibit the expression of interleukin-6, a pro-inflammatory cytokine. The CYB5R3 antibody is produced by a hybridoma cell line, ensuring its high specificity and quality. Researchers can use this antibody as a valuable tool for studying the role of CYB5R3 in various biological processes and developing potential inhibitors for therapeutic applications.ITPK1 antibody
ITPK1 antibody was raised using the N terminal of ITPK1 corresponding to a region with amino acids MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYIRactopamine antibody
The Ractopamine antibody is a specific monoclonal antibody that has been developed for research purposes in the field of Life Sciences. This antibody has high affinity and specificity for Ractopamine, making it an ideal tool for detecting and quantifying this compound in various samples. It can be used in various immunoassays such as ELISA, Western blotting, and immunohistochemistry.NEK7 antibody
NEK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIIRS1 antibody
The IRS1 antibody is a monoclonal antibody that specifically targets insulin receptor substrate 1 (IRS1). This antibody plays a crucial role in regulating insulin signaling pathways and has been widely used in various studies related to diabetes, obesity, and metabolic disorders.P21 antibody
The P21 antibody is a highly specialized polyclonal antibody that is used in various fields of life sciences. It has a high viscosity, which allows for efficient binding to target molecules. This antibody is particularly effective in neutralizing tumor necrosis factor-alpha (TNF-α), interleukin-6, interferon, and other growth factors. Its monoclonal nature ensures a specific antigen-antibody reaction, making it suitable for various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISA). Additionally, the P21 antibody can be used to detect virus surface antigens and has shown promising results as an anti-MERTK antibody. With its versatility and reliability, this antibody is an essential tool for researchers and scientists in the field of life sciences.LYSMD2 antibody
LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE
Cyclin A antibody
The Cyclin A antibody is a highly specialized and potent phosphatase inhibitor that is widely used in industrial applications. It is a monoclonal antibody that specifically targets and binds to activated Cyclin A, preventing its interaction with protein kinases and inhibiting cell division. This antibody has shown great potential as an antidiabetic medicament, as it exhibits inhibitory effects on key enzymes involved in glucose metabolism. In addition, the Cyclin A antibody has been extensively studied in the field of Life Sciences, where it has been used for molecular docking and molecular modeling experiments. Its high affinity and specificity make it an invaluable tool for researchers in various scientific disciplines.CD91 antibody
The CD91 antibody is a highly versatile product in the field of Life Sciences. It has been extensively used in various applications such as 2-deoxyglucose assays, dermal fibroblasts studies, and antibody-based assays. This antibody has shown promising results in anti-thrombotic research and has been found to play a crucial role in ferroptosis regulation. Furthermore, it has been observed to act as a secretagogue in neuroendocrine cells and exhibit strong binding affinity towards dermal binding proteins like hsp90α. The CD91 antibody is also known for its excellent staining capabilities and its ability to interact with glucose transporters. With its wide range of applications and impressive performance, this antibody is an essential tool for researchers in the field of Life Sciences.ApoE antibody
The ApoE antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets apolipoprotein E, a protein involved in the transport and metabolism of fatty acids. This antibody has been extensively studied and shown to have various applications.EPHB3 antibody
The EPHB3 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the epidermal growth factor receptor EPHB3. This antibody is widely used in research to study the role of this growth factor in various biological processes.Troponin I Type 2 antibody
Troponin I Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
CD11a antibody
The CD11a antibody is a monoclonal antibody that specifically targets the CD11a protein, which is found in human serum. This antibody has been extensively studied and shown to have high affinity and specificity for CD11a. It has been used in various research applications, including the study of autoimmune diseases such as diabetes and rheumatoid arthritis.KIAA0494 antibody
KIAA0494 antibody was raised using the N terminal of KIAA0494 corresponding to a region with amino acids DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKVERAP1 antibody
The ERAP1 antibody is a monoclonal antibody that targets vascular endothelial growth factor (VEGF). It is activated by protein kinase and has anti-angiogenic properties. This antibody can be used in Life Sciences research to study the role of VEGF in various biological processes. It can also be used in diagnostic applications to detect autoantibodies or as a therapeutic agent for conditions involving abnormal angiogenesis. The ERAP1 antibody has shown efficacy in inhibiting the growth of cancer cells and has been used in combination with other targeted therapies such as sorafenib and anti-HER2 antibodies. Its specificity for VEGF makes it a valuable tool in understanding and manipulating angiogenic pathways.ATP5A1 antibody
The ATP5A1 antibody is a highly specialized antibody used in Life Sciences research. It is commonly used in various chromatographic techniques to detect and analyze specific proteins and molecules. This antibody has been extensively studied and validated for its specificity and sensitivity.LRRC50 antibody
LRRC50 antibody was raised using the N terminal of LRRC50 corresponding to a region with amino acids TELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLK2 antibody
The K2 antibody is a highly specialized monoclonal antibody that targets tyrosine and has various applications in the field of life sciences. This antibody has been extensively studied for its interaction with liver microsomes, collagen, TNF-α, and influenza hemagglutinin. It is commonly used as a cross-linking agent in colloidal and immunological assays.GH antibody
GH antibody is a glycoprotein that consists of antibodies reactive to pancreatic glucagon. It is widely used in Life Sciences for various bioassays and immunoassays. GH antibody has the ability to bind to lipoprotein lipase and can be utilized in assays and hybridization techniques. This product is a polyclonal antibody, meaning it is derived from multiple sources and recognizes multiple epitopes on the target molecule. GH antibody specifically targets glucagon and contains tyrosine residues that play a crucial role in neutralizing its activity.RPGRIP1 antibody
The RPGRIP1 antibody is an adeno-associated virus (AAV) that is used as an affinity ligand in Life Sciences research. This antibody specifically targets and binds to the RPGRIP1 protein, which is found in the retina. It is commonly used to isolate retinal cells and study their function. The RPGRIP1 antibody can also be used in assays to detect autoantibodies or measure levels of interleukins in biological samples. Additionally, this antibody has potential therapeutic applications as it can be used to develop medicines or inhibitors that target the RPGRIP1 protein or its associated signaling pathways. With its high specificity and affinity, the RPGRIP1 antibody is a valuable tool for researchers in various fields of study.CD4 antibody
The CD4 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to CD4, a protein found on the surface of certain cells, including T-helper cells. This antibody has been extensively studied and proven to have various applications in research and diagnostics.NPM antibody
The NPM antibody is a test substance used in the field of Life Sciences. It is an isolated nucleic acid that is known for its high protein thermal stability. This antibody exhibits cytotoxic properties and has been extensively studied for its antibody activity against various targets. It has shown promising results as an anticancer agent and is being explored for its potential use in medicinal compositions. The NPM antibody is derived from bioactive natural products and is available as Polyclonal Antibodies. Its efficacy can be tested using electrophoresis techniques, and it specifically targets nuclear markers.ERBB2 antibody
ERBB2 antibody was raised in Mouse using a purified recombinant fragment of human ERBB2 (aa750-987) expressed in E. coli as the immunogen.Synapsin antibody
The Synapsin antibody is a specific antibody that has various applications in the field of life sciences. It can be used as an anticoagulant and has been found to have neutralizing effects on hepcidin and TGF-β1. This antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. It has been shown to interact with a range of antigens, including interleukin-6 (IL-6) and IL-17A, making it a versatile tool for research purposes. Additionally, this antibody can be used as a medicament in certain applications. Its ability to bind to isolated nucleic acids and fibrinogen further adds to its potential use in various scientific investigations.JunB antibody
The JunB antibody is an activated antibody that targets the JunB protein, a transcription factor involved in various cellular processes. It is commonly used in life sciences research to study the role of JunB in different signaling pathways. This antibody specifically recognizes and binds to JunB, allowing researchers to investigate its function and regulation.VWF antibody (HRP)
VWF antibody (HRP) was raised in sheep using Canine vWF purified from plasma as the immunogen.LTB4DH antibody
LTB4DH antibody was raised using the N terminal Of Ltb4Dh corresponding to a region with amino acids VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRTER119 antibody
TER119 antibody is a monoclonal antibody that targets a cell antigen involved in glycosylation processes. It is commonly used in the field of Life Sciences for research purposes. TER119 antibody specifically recognizes and binds to the TER119 antigen, which is expressed on erythroid cells. This antibody has been shown to inhibit the proton-coupled transferrin uptake by these cells, thereby affecting their growth and development. Additionally, TER119 antibody has been found to modulate interleukin-6 signaling and reduce microvessel density, suggesting its potential as an anti-angiogenic agent. With its high specificity and affinity, TER119 antibody is a valuable tool for studying erythroid cell biology and understanding the role of glycosylation in various cellular processes.CCR4 antibody
The CCR4 antibody is a polyclonal antibody that specifically targets the C-C chemokine receptor 4 (CCR4). This receptor is involved in various biological processes, including immune response and inflammation. The CCR4 antibody can be used in life sciences research to study the function and expression of CCR4. It can also be used in diagnostic applications to detect the presence of CCR4 in samples. The CCR4 antibody is produced by hybridoma cells and is available as both polyclonal and monoclonal antibodies. It has been shown to have high specificity and sensitivity in detecting CCR4. The CCR4 antibody can be used in conjunction with other antibodies or molecules to further investigate the role of CCR4 in various physiological and pathological conditions.IKBE antibody
The IKBE antibody is a monoclonal antibody that acts as a neutralizing molecule drug in the field of Life Sciences. It specifically targets insulin and has been extensively studied for its ability to inhibit the activity of TNF-α, a key inflammatory cytokine. This monoclonal antibody recognizes specific amino acid residues on the target molecule and effectively blocks its function. In addition to its role in neutralizing TNF-α, the IKBE antibody has also shown promising results in targeting other molecules such as ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) and autoantibodies associated with diseases like cryptosporidium infection. With its specificity and potential therapeutic applications, the IKBE antibody holds great promise in the field of immunotherapy.ATP6V1B1 antibody
The ATP6V1B1 antibody is a powerful tool in Life Sciences research. It is an antibody that specifically targets ATP6V1B1 protein, which plays a crucial role in the regulation of ascorbic acid transport, fatty acid metabolism, and collagen synthesis. This antibody is widely used in various applications, including immunohistochemistry, Western blotting, and ELISA assays.
CPA1 antibody
The CPA1 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets collagen and its phosphorylation site. This antibody acts as an inhibitor, preventing the substance responsible for collagen phosphorylation from functioning properly. By modulating the immune response and interfering with this process, the CPA1 antibody has potential applications in immunomodulation and treating diseases related to collagen dysfunction.RPP38 antibody
The RPP38 antibody is a serum marker that targets mesothelin, a glycoprotein expressed in various cancers. It is a polyclonal antibody commonly used in life sciences research and has been found to be an interferon-stimulated gene. The RPP38 antibody can be utilized for the detection and quantification of mesothelin levels in biological samples, making it a valuable tool for diagnostic purposes. Additionally, this antibody has shown potential therapeutic applications in the development of targeted medicines. Its ability to specifically bind to mesothelin opens up possibilities for targeted drug delivery and immunotherapy approaches. The RPP38 antibody is also being studied for its role as an autoantibody and its interaction with other cellular components such as telomerase, pluripotent stem cell markers, glycogen synthase kinase, and methyl transferase enzymes. With its versatility and specificity, the RPP38 antibody is an indispensable tool in the field of antibodies and biomedical research.CPEB3 antibody
CPEB3 antibody was raised using the middle region of CPEB3 corresponding to a region with amino acids RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSGNGAL antibody
The NGAL antibody is a monoclonal antibody that specifically targets the protein known as neutrophil gelatinase-associated lipocalin (NGAL). NGAL is involved in various physiological processes, including inflammation and tissue repair. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in its ability to neutralize the effects of TGF-beta, a growth factor involved in fibrosis and cancer progression. Additionally, the NGAL antibody has been used to inhibit endothelial growth and angiogenesis, making it a potential therapeutic option for diseases such as cancer. Furthermore, this antibody has shown efficacy in targeting amyloid plaque formation, which is implicated in neurodegenerative disorders like Alzheimer's disease. With its broad range of applications and potential therapeutic benefits, the NGAL antibody holds great promise for future research and clinical use.NGAL antibody
The NGAL antibody is a highly effective monoclonal antibody that has neutralizing properties. It targets the colony-stimulating factor and has been shown to have a significant impact on mesenchymal stem cells. This antibody works by binding to lysyl-trna synthetase, preventing it from functioning properly. The NGAL antibody is formulated with high-quality excipients and has undergone extensive testing in various assays. It is a potent medicament that can be used for a range of applications in the Life Sciences field. Additionally, this antibody has antiviral properties and can be pegylated for enhanced efficacy. With its ability to bind to specific proteins, the NGAL antibody offers promising therapeutic potential in various research and clinical settings.
