Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75602 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
TNK1 antibody
TNK1 antibody is a reactive antibody that specifically targets the TNK1 protein. TNK1 is involved in various cellular processes, including the epidermal growth factor (EGF) signaling pathway. This antibody can be used in Life Sciences research to study the role of TNK1 in different biological systems. It has been shown to bind to TNK1 with high specificity and affinity. The TNK1 antibody can also be used as a diagnostic tool for detecting TNK1 levels in patient samples. Additionally, this antibody can be used in immunohistochemistry assays to visualize the localization of TNK1 within tissues. With its ability to recognize and bind to TNK1, this antibody offers researchers a valuable tool for understanding the function of this protein in various cellular processes.Cortactin antibody
Cortactin antibody was raised using the N terminal of CTTN corresponding to a region with amino acids KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGDEP1 antibody
The DEP1 antibody is a powerful inhibitory factor that belongs to the family of antibodies. It interacts with mitogen-activated proteins and annexin A2, playing a crucial role in various life sciences applications. This antibody exhibits strong DNA binding activity and has been extensively studied in the context of leukemia inhibitory factor (LIF) signaling pathways. Through its ability to regulate polymerase chain reactions and adenosine A1 receptors, the DEP1 antibody influences cytokine production and transmembrane conductance. With its high specificity and potency, this polyclonal antibody is an essential tool for researchers in the field of life sciences.APLP1 antibody
The APLP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it versatile for various research purposes. This antibody specifically targets APLP1, which stands for amyloid precursor-like protein 1. APLP1 is involved in various cellular processes, including retinoid metabolism and methyl transferase activity.TRKC antibody
The TRKC antibody is a water-soluble monoclonal antibody used in Life Sciences. It is specifically designed to target and bind to the TRKC receptor, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to have high affinity and specificity for its target.HSPBP1 antibody
The HSPBP1 antibody is a highly specialized product used in the field of Life Sciences. It is an activated antibody that has been developed to specifically target and bind to HSPBP1, a metal-binding protein involved in various cellular processes. The antibody can be used for a range of applications, including research studies, diagnostic assays, and therapeutic purposes.PKNOX1 antibody
The PKNOX1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the PKNOX1 protein, a human protein that plays a crucial role in various cellular processes. This antibody has been extensively characterized and exhibits high specificity and affinity towards PKNOX1.
UHRF1 antibody
The UHRF1 antibody is a polyclonal antibody that specifically targets the protein UHRF1. UHRF1 plays a crucial role in epigenetic regulation and is involved in various cellular processes, including DNA methylation, chromatin remodeling, and gene expression. This antibody allows for the detection and analysis of UHRF1 levels in different biological samples.FGF21 antibody
The FGF21 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to FGF21, a growth factor involved in various biological processes. This antibody has been extensively studied and characterized for its ability to inhibit the activity of FGF21.
SIX6 antibody
The SIX6 antibody is a growth factor that belongs to the class of polyclonal antibodies. It specifically targets and binds to the SIX6 protein, which plays a crucial role in eye development. The antibody has been extensively studied for its ability to detect and measure the levels of SIX6 in various biological samples.HSP60 antibody
The HSP60 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the heat shock protein 60 (HSP60), which plays a crucial role in cellular stress response and protein folding. This antibody is widely used in various applications, including immunoblotting, immunohistochemistry, and flow cytometry.Cytokeratin 8 antibody
The Cytokeratin 8 antibody is a highly effective diagnostic reagent used in various research and medical applications. It is an activated antibody that specifically targets catecholaminergic neurons, making it ideal for studying the function and characteristics of these cells.Clenbuterol antibody
The Clenbuterol antibody is a monoclonal antibody that has neutralizing properties. It specifically targets and binds to Clenbuterol, a synthetic drug commonly used as a bronchodilator and for its anabolic effects. This antibody effectively blocks the activity of Clenbuterol, preventing it from binding to its target receptors.PDS5B antibody
PDS5B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK
TXK antibody
The TXK antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and inhibit the chemokine known as TXK, which plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be effective in blocking the activation of TXK.CPE antibody
The CPE antibody is a life sciences product that serves as a serum marker for various applications. This antibody specifically targets and binds to the protein known as CPE (carboxypeptidase E), which plays a crucial role in several biological processes. With its high specificity and affinity, the CPE antibody can be used in research, diagnostics, and therapeutics.
MYH9 antibody
MYH9 antibody was raised using the middle region of MYH9 corresponding to a region with amino acids DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPMP22 antibody
PMP22 antibody is a chemokine that exhibits cytotoxic properties and acts as an immunomodulatory agent. It has been shown to have anticancer activity by targeting reactive cells and inhibiting their growth. Additionally, PMP22 antibody possesses antiviral properties and is effective against multidrug-resistant viruses. In laboratory studies, this antibody has demonstrated its ability to bind to specific proteins and neutralize their effects. It can be used in various research applications in the field of life sciences, including but not limited to the development of monoclonal antibodies and interferon therapies. With its diverse range of functions, PMP22 antibody holds great potential for advancing scientific discoveries and medical breakthroughs.NEDD8 antibody
The NEDD8 antibody is a powerful tool in Life Sciences research. It is an interferon-induced protein that plays a crucial role in cell growth, differentiation, and survival. This antibody specifically targets NEDD8, neutralizing its activity and preventing it from binding to its target proteins. By inhibiting the function of NEDD8, this antibody can provide valuable insights into the molecular mechanisms underlying various cellular processes.Src antibody
The Src antibody is a specific antibody that targets protein kinases known as Src. This antibody acts as an enzyme inhibitor by blocking the activity of Src and preventing its phosphorylation of tyrosine residues. It also inhibits the action of phosphatases, which play a role in regulating cellular signaling pathways. The Src antibody is commonly used in Life Sciences research to study various cellular processes, including cell growth, differentiation, and migration. It has been widely utilized in studies involving polyclonal antibodies and has shown efficacy in detecting threonine phosphorylation events. This antibody can be used with human serum samples or isolated nucleic acids to investigate the role of Src in different signaling pathways, such as those involving epidermal growth factor or mitogen-activated protein kinases.His tag antibody
The His tag antibody is a monoclonal antibody that specifically recognizes and binds to the histidine (His) tag sequence. The histidine tag is commonly added to recombinant proteins for easy purification and detection. This antibody has been widely used in various applications such as protein-protein interactions, electrophoresis, and immunoassays. The His tag antibody can be used to detect the presence of His-tagged proteins in biological samples. It offers high specificity and sensitivity, allowing for accurate quantification of target proteins. Additionally, this antibody has low cross-reactivity with other proteins, ensuring reliable results. In addition to its use in research laboratories, the His tag antibody has also found applications in the biopharmaceutical industry. It plays a crucial role in the development and production of therapeutic proteins, including monoclonal antibodies like trastuzumab and erythropoietin. Overall, the His tag antibody is an essential tool for scientists working in life sciences research, protein engineeringSEK1 antibody
SEK1 antibody is a highly specialized monoclonal antibody that targets the growth factor phosphatase. It has been extensively studied and proven to have cytotoxic effects on various types of cancer cells. This antibody specifically binds to the glutamate receptor, inhibiting its activity and preventing the growth and proliferation of cancerous cells. In addition, SEK1 antibody has shown promising results in bioassays, demonstrating its ability to induce apoptosis and inhibit tumor growth. Its high specificity and affinity make it an ideal tool for researchers in the field of Life Sciences who are studying the mechanisms of cell growth and development.CYP1A2 antibody
The CYP1A2 antibody is a highly specific monoclonal antibody that targets the cytochrome P450 1A2 enzyme. This antibody is widely used in life sciences research and drug development to study the role of CYP1A2 in drug metabolism and toxicity. It has been shown to effectively inhibit the activity of CYP1A2 in liver microsomes, leading to a decrease in the metabolism of certain drugs. The CYP1A2 antibody can also be used as an electrode immobilization agent for the development of biosensors and diagnostic assays. Its high affinity for CYP1A2 binding proteins makes it a valuable tool for studying protein-protein interactions and antagonist binding. With its exceptional specificity and reliability, this monoclonal antibody is an essential component in any research involving CYP1A2.AXIN1 antibody
The AXIN1 antibody is a monoclonal antibody that targets the protein AXIN1, which plays a crucial role in the regulation of the Wnt signaling pathway. This pathway is involved in various cellular processes and has been implicated in diseases such as cancer. The AXIN1 antibody specifically binds to AXIN1 and can be used for research purposes in Life Sciences or as a potential therapeutic agent.
Cytokeratin 16 antibody
The Cytokeratin 16 antibody is a highly specialized product in the field of Life Sciences. It is an inhibitor that targets creatine kinase, dopamine, and other related enzymes. This monoclonal antibody is designed for the specific detection and immobilization of the nuclear isoform of cytokeratin 16.STX6 antibody
The STX6 antibody is a highly reactive histidine-based growth factor that has been extensively studied in the field of Life Sciences. It is specifically designed to target and bind to mesothelin, a protein that is overexpressed in certain types of cancer cells. The STX6 antibody has shown promising results in inhibiting the growth and proliferation of cancer cells by blocking the interaction between mesothelin and its receptor.PNMT antibody
The PNMT antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the phenylethanolamine N-methyltransferase (PNMT) enzyme. This antibody has various applications, including in assays and studies related to trastuzumab, androgen, growth factors, and cortisol. It can be used to detect and measure the levels of PNMT in samples, as well as study its role in different biological processes. The PNMT antibody is a valuable tool for researchers working with antibodies and active agents in their experiments.PR antibody
PR antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that specifically targets glutamate and has monoclonal antibody properties. This antibody has been extensively studied for its role in regulating various biological processes, including the TGF-beta signaling pathway, collagen synthesis, and the modification of sugar moieties on proteins.
NIT1 antibody
NIT1 antibody was raised using the N terminal of NIT1 corresponding to a region with amino acids VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC
USP7 antibody
The USP7 antibody is a highly specialized biomolecule used in Life Sciences research. It is a monoclonal antibody that has been developed for chromatographic applications, specifically for the immobilization of collagen and other biomolecules. This antibody exhibits high affinity and specificity towards its target antigen, making it an excellent tool for various laboratory techniques.ELOVL7 antibody
ELOVL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSAprotinin antibody
The Aprotinin antibody is a monoclonal antibody that targets the glycopeptide Aprotinin. This antibody has been shown to have a significant impact on various aspects of Life Sciences research. It has been found to inhibit the expression of E-cadherin, a protein involved in cell adhesion and migration. Additionally, the Aprotinin antibody has been used in studies investigating the role of interferon in adipose tissue and adipocyte function. It has also been utilized as a tool for studying insulin signaling and inhibitors of fatty acid metabolism. With its wide range of applications, this Aprotinin antibody is an essential tool for researchers in the field of Life Sciences.SP110 antibody
The SP110 antibody is a monoclonal antibody that specifically targets the SP110 protein. This protein is involved in various cellular processes, including fibrinogen metabolism and regulation of mesenchymal stem cells. The SP110 antibody has been shown to have cytotoxic effects on cancer cells by activating caspase-9, a key enzyme involved in apoptosis. Additionally, this antibody can inhibit the activity of certain kinases, making it a potential therapeutic option for diseases related to kinase dysregulation. The SP110 antibody is widely used in life sciences research and has applications in fields such as immunology and oncology. It offers researchers a valuable tool for studying the function and regulation of the SP110 protein and its involvement in various biological pathways.CD80 antibody
The CD80 antibody is a growth factor that consists of acid residues. It belongs to the class of antibodies and specifically targets TGF-beta. This monoclonal antibody can be used in various applications in the Life Sciences field. It has been shown to neutralize the activity of CD80, which is involved in the regulation of immune responses. The CD80 antibody can be used in experiments involving transferrin or streptavidin as it binds specifically to these molecules. Additionally, it has been shown to have a trifunctional effect on mesenchymal stem cells, including promoting their proliferation, differentiation, and migration. This monoclonal antibody is highly specific and exhibits high affinity for its target molecule. Researchers can use the CD80 antibody as a valuable tool in their studies focused on understanding immune responses and developing therapeutic inhibitors.SULT1B1 antibody
SULT1B1 antibody was raised using the N terminal of SULT1B1 corresponding to a region with amino acids MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGAP2M1 antibody
The AP2M1 antibody is a monoclonal antibody that targets specific growth factors in the body. It is commonly used in the field of biomaterials and life sciences for various research purposes. This antibody has been shown to specifically bind to epidermal growth factor (EGF), which plays a crucial role in cell proliferation and differentiation. By neutralizing the activity of EGF, the AP2M1 antibody can help regulate cellular processes and potentially impact disease progression.CD5 antibody
CD5 antibody is a monoclonal antibody that targets CD5, a protein expressed on the surface of certain cells, including MDA-MB-231 breast cancer cells. This antibody can be used in various life science applications, such as cell-based assays and immunohistochemistry. CD5 antibody has been shown to have cytotoxic effects on cancer cells and may be useful in combination with other anti-cancer drugs. Additionally, this antibody can be used in studies involving cardiac muscle troponin and glucagon. Its specificity and effectiveness make it a valuable tool for researchers in the field of molecular biology and drug discovery.STAT2 antibody
The STAT2 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the STAT2 protein, which plays a crucial role in signal transduction and immune response. This antibody can be used to study various cellular processes such as growth factor signaling, fatty acid metabolism, and phosphatase activity. The STAT2 antibody is highly specific and has been validated for use in different applications including Western blotting, immunohistochemistry, and immunofluorescence. It is produced using state-of-the-art techniques to ensure high quality and reliability. Additionally, this antibody has been purified using serum albumin-binding cellulose columns to eliminate any non-specific binding. Trust the STAT2 antibody for accurate and reproducible results in your research experiments.CD41 antibody
The CD41 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the CD41 protein, which is involved in various biological processes such as collagen binding and TGF-beta signaling. This antibody is highly effective in detecting and quantifying CD41 expression levels in different cell types.WISP1 antibody
The WISP1 antibody is a complex of polyclonal antibodies that are used in the field of Life Sciences. This antibody specifically targets the WISP1 growth factor, which plays a crucial role in cell proliferation and differentiation. The WISP1 antibody has been shown to inhibit the activity of carboxyl esterase, an enzyme involved in the metabolism of various medicaments. By binding to WISP1, this antibody prevents its interaction with other binding proteins, thereby inhibiting downstream signaling pathways. Additionally, the WISP1 antibody can be used as a fluorescence probe to visualize the presence and localization of WISP1 in cells and tissues. It has also been studied as a potential formation inhibitor for colloidal aggregates and as a therapeutic agent for conditions such as ischemia reperfusion injury. Furthermore, studies have indicated that the WISP1 antibody may have antiviral properties by modulating interferon and TGF-β1 signaling pathways. Overall, the WISP1 antibody holds great promise inTNFRSF11B antibody
TNFRSF11B antibody was raised in Mouse using a purified recombinant fragment of human TNFRSF11B expressed in E. coli as the immunogen.Cytokeratin 19 antibody
Cytokeratin 19 antibody is a low-molecular-weight monoclonal antibody that specifically binds to cytokeratin 19, a protein found in epithelial cells. This antibody has been used in various applications in the field of life sciences, including research and diagnostics. It can be used to detect and quantify cytokeratin 19 expression in tissues and cells, making it a valuable tool for studying epithelial cell biology. The dextran sulfate conjugated to the antibody enhances its stability and allows for efficient binding to target molecules. Whether you're conducting experiments or developing new diagnostic assays, this cytokeratin 19 antibody is an essential component for your research toolkit. Trust its high specificity and sensitivity to deliver accurate and reliable results.ASCL1 antibody
The ASCL1 antibody is a highly effective monoclonal antibody that targets and inhibits the activity of ASCL1, a transcription factor involved in the regulation of gene expression. This antibody has been extensively studied and proven to have significant therapeutic potential in various fields, including life sciences and medicine.CBLB antibody
CBLB antibody was raised in mouse using recombinant Human Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence BCXADR antibody
The CXADR antibody is a highly specialized polyclonal antibody that targets the CXADR protein. This protein plays a crucial role in cell adhesion and is involved in various biological processes such as collagen synthesis, cell signaling, and growth factor regulation. The CXADR antibody can be used for a wide range of applications in life sciences research, including immunohistochemistry, western blotting, and ELISA.
BAX antibody
The BAX antibody is a highly specific monoclonal antibody that targets the BAX protein, which plays a crucial role in apoptosis (programmed cell death). This antibody has been extensively studied in the field of thrombotic thrombocytopenic purpura (TTP), a rare blood disorder characterized by the formation of blood clots in small blood vessels throughout the body.Cofilin antibody
Cofilin antibody is a monoclonal antibody that specifically targets cofilin, an essential protein involved in actin dynamics. This antibody is widely used in immunoassays and research applications to study the functions and regulation of cofilin. It can be used for receptor binding studies, as well as for detecting activated cofilin in cells and tissues. Additionally, the cofilin antibody can be utilized for antigen binding assays and as a tool to investigate the role of cofilin in various biological processes such as cell migration, cytoskeletal rearrangement, and cellular signaling pathways. With its high specificity and affinity, this monoclonal antibody is a valuable tool for Life Sciences researchers studying actin dynamics and related processes.TCF7L1 antibody
The TCF7L1 antibody is a monoclonal antibody that is used to detect and target specific proteins in cells. It has been shown to have cytotoxic effects on certain cell types, making it an effective tool for research and therapeutic applications. The TCF7L1 antibody can be used to study the role of TCF7L1 in various biological processes, such as cell growth, differentiation, and development. It is also commonly used in immunohistochemistry and Western blotting techniques to detect the presence of TCF7L1 in tissue samples. This antibody is highly specific and does not cross-react with other contaminants or proteins, ensuring accurate and reliable results. In addition, the TCF7L1 antibody can be used in combination with other antibodies or growth factors to investigate complex cellular pathways and interactions. Its versatility makes it an invaluable tool for researchers in the life sciences field.
TRIM42 antibody
TRIM42 antibody was raised using the C terminal of TRIM42 corresponding to a region with amino acids VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQM
