Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75602 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
CPEB4 antibody
CPEB4 antibody was raised using the N terminal of CPEB4 corresponding to a region with amino acids DEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQGDSF3B14 antibody
SF3B14 antibody was raised using the middle region of SF3B14 corresponding to a region with amino acids HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPKAATF antibody
The AATF antibody is a monoclonal antibody that targets the AATF protein. It has been shown to be effective in inhibiting the growth of cancer cells, particularly in breast cancer (MCF-7) cells. The AATF antibody works by blocking the interaction between AATF and other proteins involved in cell proliferation and survival, such as adalimumab and interleukin-6. This inhibition leads to a decrease in tumor necrosis factor-alpha (TNF-α) production and ultimately hinders cancer cell growth.MMP15 antibody
The MMP15 antibody is a powerful tool used in Life Sciences research. It specifically targets and neutralizes the activity of matrix metalloproteinase 15 (MMP15), an enzyme involved in various biological processes such as tissue remodeling, wound healing, and cancer progression.GLCCI1 antibody
GLCCI1 antibody was raised using the middle region of GLCCI1 corresponding to a region with amino acids PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSADPRKRA antibody
PRKRA antibody was raised in mouse using recombinant Human Protein Kinase, Interferon-Inducible Double Stranded Rna Dependent ActivatorSETD7 antibody
The SETD7 antibody is a monoclonal antibody that specifically targets SETD7, an enzyme involved in various cellular processes. This antibody has been shown to react with levothyroxine and interleukin-6, indicating its potential role in modulating thyroid hormone levels and immune responses. Additionally, the SETD7 antibody has demonstrated reactivity towards basic proteins such as collagen, suggesting its involvement in extracellular matrix remodeling. Furthermore, this monoclonal antibody may have implications in cholinergic signaling due to its reactivity with acetylcholine and acetyltransferase. Overall, the SETD7 antibody shows promise as a versatile tool for studying protein function and exploring potential therapeutic applications.TP53 antibody
The TP53 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the TP53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The TP53 antibody binds to the collagen and actin filaments within cells, allowing for the detection and study of TP53 expression levels.GPR18 antibody
The GPR18 antibody is a monoclonal antibody that specifically targets the G protein-coupled receptor 18 (GPR18). This receptor is located on the apical membrane of various cell types, including functional endothelial cells. The GPR18 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.CCL5 antibody
The CCL5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed for neutralizing the activity of CCL5, a chemokine involved in various cellular processes such as inflammation and immune response. This antibody binds to the CCL5 antigen, blocking its interaction with receptors and preventing downstream signaling events.AFP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting strong bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its effectiveness has been demonstrated in various studies using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.C1ORF103 antibody
C1ORF103 antibody was raised using the middle region of C1Orf103 corresponding to a region with amino acids SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVTWDR34 antibody
WDR34 antibody was raised using the C terminal of WDR34 corresponding to a region with amino acids SLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDES
KCTD21 antibody
KCTD21 antibody was raised using the middle region of KCTD21 corresponding to a region with amino acids VFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVMMP19 antibody
The MMP19 antibody is a monoclonal antibody that specifically targets the matrix metalloproteinase 19 (MMP19). This glycoprotein plays a crucial role in various biological processes, including tissue remodeling and wound healing. The MMP19 antibody is widely used in Life Sciences research to study the function and regulation of MMP19.ING3 antibody
ING3 antibody was raised using the N terminal of ING3 corresponding to a region with amino acids MDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQ
CD23 Antibody
The CD23 Antibody is a monoclonal antibody that targets the IL-2 receptor, specifically the low-affinity receptor. This antibody has been extensively studied in in-vitro culture and Life Sciences research. It has been shown to have various biological activities, including growth factor activity and antioxidant activity. The CD23 Antibody binds to the CD23 receptor molecule, which is expressed on various cell types, such as granulosa cells. This antibody can be used in experiments involving transcription-polymerase chain reaction (PCR) or immunohistochemistry. It is an essential tool for researchers working with Monoclonal Antibodies and studying various biological processes.TREM2 antibody
TREM2 antibody was raised using the middle region of TREM2 corresponding to a region with amino acids FPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASAECHDC3 antibody
ECHDC3 antibody was raised using the N terminal of ECHDC3 corresponding to a region with amino acids SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDYUEVLD antibody
UEVLD antibody was raised using the middle region of UEVLD corresponding to a region with amino acids SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGERRAGC antibody
RRAGC antibody was raised using the N terminal of RRAGC corresponding to a region with amino acids RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQTTL antibody
The TTL antibody is an activated antibody that specifically targets interleukin-6 (IL-6) and interferon (IFN). It has been extensively studied in the field of Life Sciences and has shown significant potential in various applications. The TTL antibody has a high affinity for IL-6 and IFN, enabling it to effectively neutralize their activity in human serum. Additionally, this antibody has been found to interact with actin filaments, which play a crucial role in cellular structure and function. By binding to actin, the TTL antibody can modulate actin dynamics and potentially impact cell migration and other cellular processes. This polyclonal antibody offers exceptional specificity and sensitivity, making it an invaluable tool for researchers studying cytokine signaling pathways, immunology, and cellular biology. With its ability to target multiple key proteins involved in immune response regulation, the TTL antibody holds great promise for therapeutic interventions aimed at modulating immune system activity.HSPE1 antibody
HSPE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVDIRS1 antibody
The IRS1 antibody is a highly specialized monoclonal antibody that specifically targets and neutralizes the phosphatase activity of IRS1, a surface glycoprotein involved in various cellular processes. This antibody has been extensively tested and validated using human serum, making it a reliable tool for research in the field of Life Sciences.
CRABP1 antibody
CRABP1 antibody was raised in mouse using recombinant human CRABP1 (1-137aa) purified from E. coli as the immunogen.ZCCHC13 antibody
ZCCHC13 antibody was raised using the middle region of ZCCHC13 corresponding to a region with amino acids GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMSEXO1 antibody
The EXO1 antibody is a highly specific and sensitive polyclonal antibody used in the field of Life Sciences. It is widely recognized for its ability to detect and target a variety of proteins, making it an essential tool in many research applications. This antibody has been extensively tested and validated, ensuring reliable and accurate results.
TNF alpha antibody
The TNF alpha antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes tumor necrosis factor-alpha (TNF-α), a key player in inflammation and immune response. By binding to TNF-α, this antibody inhibits its activity, preventing it from interacting with its receptors and triggering inflammatory responses.LDB3 antibody
LDB3 antibody was raised using the N terminal of LDB3 corresponding to a region with amino acids PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPSHemoglobin antibody
The Hemoglobin antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and binds to hemoglobin, a protein found in red blood cells that carries oxygen throughout the body. By binding to hemoglobin, this antibody can be used to study its function and regulation.PKN1 antibody
The PKN1 antibody is a cell proliferation inhibitory agent that belongs to the group of Polyclonal Antibodies. It has been shown to inhibit the growth of lymphocytic choriomeningitis by blocking the action of chemokines. This antibody can be used in vitro assays to study the effects of PKN1 on cell proliferation and migration. The PKN1 antibody is available as a monoclonal antibody, which means it specifically targets and neutralizes the PKN1 protein. It can be delivered using various methods, including the emulsion-solvent evaporation method. In addition to its cell growth inhibitory properties, this antibody also exhibits an antiangiogenic effect by blocking the growth of blood vessels. The PKN1 antibody is widely used in research laboratories and life sciences industries for its potential as a therapeutic medicament.PRKAR1A antibody
PRKAR1A antibody was raised in mouse using recombinant Human Protein Kinase, Camp-Dependent, Regulatory, Type I, Alpha (Tissue Specific Extinguisher 1) (Prkar1A)NOVA2 antibody
NOVA2 antibody was raised using the middle region of NOVA2 corresponding to a region with amino acids EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASPATP6V0D2 antibody
ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPISTAT5B antibody
STAT5B antibody is an essential tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets STAT5B, a protein involved in various cellular processes such as cell growth, differentiation, and survival. This antibody is widely used in research to study the role of STAT5B in angiogenesis, neurotrophic factors, and growth factor signaling pathways.
CD3 antibody (Azide Free)
CD3 antibody (Azide free0 was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.
