Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
APPL1 antibody
The APPL1 antibody is a globulin protein used in Life Sciences research. It specifically targets messenger RNA (mRNA) and plays a crucial role in various biological processes. This monoclonal antibody has been shown to interact with influenza hemagglutinin, which is involved in viral entry into host cells. Additionally, the APPL1 antibody is known to regulate iron homeostasis and hepatocyte growth, making it an essential tool for studying these processes. It can also be used to detect glycoproteins, such as fibrinogen, and has applications in Polyclonal Antibodies research. Furthermore, this antibody has been used to study proteins involved in steroid metabolism and ferritin synthesis. Its ability to neutralize oxidative damage makes it a valuable asset for investigating cellular responses to stress.TNFSF11 antibody
The TNFSF11 antibody is a polyclonal antibody commonly used in life sciences research. It is an essential protein reagent that plays a crucial role in various biological processes. This antibody specifically targets the TNFSF11 protein, also known as RANKL (Receptor Activator of Nuclear Factor Kappa-B Ligand).
TUSC2 antibody
The TUSC2 antibody is a highly versatile product used in the field of Life Sciences. It is derived from recombinant allergens and exhibits strong binding capabilities to specific polypeptide sequences. This antibody has been extensively studied and proven effective in various applications.GOLM1 antibody
The GOLM1 antibody is a specific antibody that targets the Golgi membrane protein 1 (GOLM1). It is a monoclonal antibody that has been developed to detect and bind to GOLM1, which is involved in various cellular processes. This antibody can be used for research purposes, such as studying the function of GOLM1 in different cell types or investigating its role in disease development. The GOLM1 antibody has also shown potential as a serum marker for certain conditions, making it a valuable tool for diagnostic applications. With its high specificity and sensitivity, this antibody offers researchers and clinicians a reliable means of studying and detecting GOLM1 in various biological samples.
SKIV2L antibody
SKIV2L antibody was raised using a synthetic peptide corresponding to a region with amino acids SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPGAD1 antibody
GAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFFactor XIII Subunit A antibody (HRP)
Factor XIII Subunit A antibody (HRP) was raised in sheep using human Factor XIII Subunit A (A2) purified from plasma as the immunogen.Heparin Binding Protein Antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. It has been extensively studied using advanced techniques like transcription-quantitative polymerase chain reaction and patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.GATA1 antibody
GATA1 antibody was raised in Mouse using a purified recombinant fragment of human GATA1 expressed in E. coli as the immunogen.HDAC6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thus inhibiting bacterial growth and preventing transcription and replication. With its patch-clamp technique, it has been proven to have a high frequency of human activity. The metabolization process involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, leading to inhibited cell growth in culture.RELT antibody
RELT antibody is a monoclonal antibody that specifically targets ferritin, a protein involved in iron homeostasis. This antibody has been shown to inhibit oxidative damage caused by ferritin and prevent the accumulation of iron in cells. In addition, RELT antibody has shown potential therapeutic effects against various diseases, including influenza hemagglutinin and fibrinogen-related disorders. It has also been found to inhibit the growth of hepatocyte growth factor-dependent tumors. This monoclonal antibody derivative works by binding to specific epitopes on ferritin and blocking its activity. By targeting ferritin at the molecular level, RELT antibody offers a promising approach for the development of targeted therapies in Life Sciences.
PNMA1 antibody
PNMA1 antibody was raised using the middle region of PNMA1 corresponding to a region with amino acids LNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANHALMS1 antibody
The ALMS1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the ALMS1 protein, which is an oncogene homolog. The antibody has been extensively tested and validated for its specificity and sensitivity. It can be used in various applications such as Western blotting, immunohistochemistry, and ELISA.
CSF1 antibody
CSF1 antibody was raised in Mouse using a purified recombinant fragment of human CSF1 expressed in E. coli as the immunogen.Histone H4 antibody
Histone H4 antibody is a polyunsaturated antibody that specifically targets the histone H4 protein. This antibody has been shown to neutralize the activity of arachidonic acid, a key molecule involved in various biological processes. By blocking the action of arachidonic acid, this antibody can inhibit the angiogenic response and reduce inflammation. It has also been used in Life Sciences research to study the effects of chemical inhibitors on erythropoietin and other angiogenesis-related proteins. Additionally, this monoclonal antibody has been utilized to investigate the role of histone H4 in arachidonic acid metabolism and its impact on cellular processes. With its high specificity and ability to target activated histone H4 residues, this antibody is an essential tool for studying the intricate mechanisms of arachidonic acid signaling pathways and their involvement in various physiological and pathological conditions.MCL1 antibody
The MCL1 antibody is a monoclonal antibody used in clinical settings for immunohistochemistry. It specifically targets the protein kinase CYP2A6 and is commonly used in Life Sciences research. This antibody plays a crucial role in the detection and analysis of MCL1 protein expression, making it a valuable tool in various scientific studies. Additionally, the MCL1 antibody has potential therapeutic applications as an effective medicament against certain diseases. Its high specificity and sensitivity make it a reliable choice for immunohistochemical detection, providing accurate and reliable results. Whether used in research or clinical settings, this monoclonal antibody offers great potential for advancing scientific understanding and improving patient care.UCHL1 antibody
The UCHL1 antibody is a powerful tool used in Life Sciences research. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody targets UCHL1, a growth factor that plays a crucial role in various biological processes.CRP antibody
The CRP antibody is a highly effective growth factor that activates insulin and is commonly used in the field of Life Sciences. This monoclonal antibody has been specifically designed to target and neutralize phosphatase, which plays a crucial role in various biological processes. The CRP antibody is produced using advanced colloidal techniques, ensuring high purity and potency.TNFC antibody
TNFC antibody is a powerful tool used in Life Sciences research for studying the role of tumor necrosis factor (TNF) in various biological processes. This polyclonal antibody specifically targets TNF and can be used to detect and quantify its presence in samples. TNFC antibody binds to TNF, preventing its interaction with its receptors and inhibiting downstream signaling pathways. It has been extensively used to study the effects of TNF on epidermal growth factor signaling, insulin sensitivity, lipoprotein lipase activity, and glutamate release in mesenchymal stem cells. Additionally, TNFC antibody has been employed in autoimmune disease research to investigate the presence of autoantibodies against TNF or its receptors. Researchers also use monoclonal antibodies such as anti-HER2 antibody or trastuzumab alongside TNFC antibody to study complex protein interactions and signaling pathways involving TNF. With its high specificity and sensitivity, TNFC antibody is an invaluable tool for understanding the role of TNFClaudin 1 antibody
The Claudin 1 antibody is an acidic monoclonal antibody that specifically targets the claudin 1 protein. It is commonly used in Life Sciences research to study the role of claudin 1 in various cellular processes. This antibody has been shown to have neutralizing effects on claudin 1, which plays a crucial role in cell adhesion and tight junction formation. By blocking the function of claudin 1, this antibody can inhibit the growth and migration of cells. Additionally, it has been found to have neurotrophic properties and can promote the survival and differentiation of neurons. The Claudin 1 antibody is a valuable tool for researchers studying cell biology, cancer biology, and neurobiology.FGFR4 Antibody
The FGFR4 Antibody is a powerful inhibitor that targets the protein kinase activity of fibroblast growth factor receptor 4 (FGFR4). This monoclonal antibody specifically binds to FGFR4, blocking its activation and preventing downstream signaling pathways. It has been shown to have high affinity for human serum albumin, making it suitable for use in various research applications.PKC gamma antibody
PKC gamma antibody is a monoclonal antibody that specifically targets and inhibits the activity of protein kinase C gamma (PKC gamma). It is designed to selectively bind to PKC gamma, preventing its activation and downstream signaling pathways. This antibody utilizes a biocompatible polymer linker group with a disulfide bond for stability and cytotoxicity.
SHH antibody
The SHH antibody is a monoclonal antibody that specifically targets the Sonic Hedgehog (SHH) protein. It is used in Life Sciences research to study the function and regulation of SHH signaling pathway. The SHH protein plays a crucial role in embryonic development, cell differentiation, and tissue regeneration. This antibody can be used for various applications such as Western blotting, immunohistochemistry, and flow cytometry to detect and quantify the expression of SHH protein in different biological samples. Additionally, the SHH antibody has been shown to have potential therapeutic applications in diseases related to abnormal SHH signaling, including certain types of cancer and developmental disorders. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying SHH-related pathways and exploring new therapeutic strategies.PRPF4 antibody
PRPF4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITCHCHD1 antibody
CHCHD1 antibody was raised using the middle region of CHCHD1 corresponding to a region with amino acids KEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLHNRPUL1 antibody
HNRPUL1 antibody was raised using the C terminal of HNRPUL1 corresponding to a region with amino acids TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQNucleobindin 2 antibody
Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKEVitronectin antibody (HRP)
Vitronectin antibody (HRP) was raised in sheep using human Vitronectin purified from plasma as the immunogen.NF kappaB p65 antibody
The NF kappaB p65 antibody is a glycoprotein that plays a crucial role in various cellular processes, including the regulation of immune responses and inflammation. It is a mitogen-activated protein that acts as a transcription factor and controls the expression of genes involved in cell survival, proliferation, and differentiation.FADS1 antibody
FADS1 antibody was raised using the C terminal of FADS1 corresponding to a region with amino acids FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLLITLN2 antibody
ITLN2 antibody was raised using the middle region of ITLN2 corresponding to a region with amino acids TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQACNTF antibody
The CNTF antibody is a polyclonal antibody used in Life Sciences research. It is designed to specifically target and bind to CNTF (Ciliary Neurotrophic Factor), a protein involved in neural development and survival. This antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA.C3ORF24 antibody
C3ORF24 antibody was raised using the middle region of C3Orf24 corresponding to a region with amino acids KLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRVCNTN2 antibody
The CNTN2 antibody is a highly specialized monoclonal antibody that exhibits cytotoxic properties. It is designed to target and bind to the CNTN2 protein, which plays a crucial role in various biological processes related to cell growth and development. By binding to CNTN2, this antibody effectively inhibits its function and disrupts the signaling pathways associated with it.Luteinizing Hormone antibody
The Luteinizing Hormone antibody is a powerful tool in the field of Life Sciences. It is commonly used for hybridization studies and as an inhibitor for ethionamide. This antibody specifically targets the luteinizing hormone, a key molecule involved in reproductive processes. By binding to this hormone, the antibody can modulate its activity and provide valuable insights into its function.C12ORF40 antibody
C12ORF40 antibody was raised using the N terminal Of C12Orf40 corresponding to a region with amino acids ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVNTGF alpha antibody
TGF alpha antibody is a monoclonal antibody that specifically targets and inhibits the activity of transforming growth factor alpha (TGF-α). TGF-α is a potent mitogen and growth factor that plays a crucial role in various biological processes, including cell proliferation, differentiation, and tissue repair. This antibody has been extensively characterized and validated for its high specificity and potency in neutralizing TGF-α activity.PELI1 antibody
PELI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAASAE1 antibody
SAE1 antibody is a medicament that acts as an inhibitor of growth factors in adipose tissue. It is an antibody that specifically targets SAE1, a protein involved in various cellular processes. This polyclonal antibody has neutralizing properties, meaning it can block the activity of SAE1 and its associated pathways. In the field of Life Sciences, SAE1 antibody is widely used for research purposes, particularly in the study of adipose tissue and its role in metabolic disorders. It has also been shown to have potential therapeutic applications in diseases such as obesity and diabetes. With its ability to target specific proteins and pathways, SAE1 antibody offers new possibilities for understanding and treating various health conditions.
RBM4 antibody
RBM4 antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids LQQQPLLLLLQLPLHITGGIGAPCVALQPQSPLLERATVTGMRVSCPKLQ
ARL13B antibody
ARL13B antibody was raised using the middle region of ARL13B corresponding to a region with amino acids VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKGBE1 antibody
The GBE1 antibody is a highly specialized antibody that targets the interferon-stimulated gene (ISG) protein. It is also effective in targeting anti-mesothelin and telomerase proteins. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. It has been found to enhance oxygen uptake and improve cellular metabolism. The GBE1 antibody is a monoclonal antibody, meaning it is produced from a single clone of cells, ensuring high specificity and consistency. It can be used as a serum marker to detect the presence of activated ISG proteins and can also be utilized in glycogen synthase kinase assays. This antibody holds great potential as a medicament for various diseases and conditions and is widely regarded as one of the most effective antibodies available in the market today.FOXO4 antibody
The FOXO4 antibody is a monoclonal antibody that specifically targets and inhibits the activity of hepatocyte growth factor. It is commonly used in Life Sciences research for the immobilization and purification of activated FOXO4 protein. This antibody has been shown to have neutralizing effects on the binding of angiopoietin-like protein 3 (ANGPTL3) and other binding proteins to collagen, thereby preventing their cytotoxic effects. Additionally, polyclonal antibodies against FOXO4 have also been developed for various applications in scientific research.DDX19B antibody
DDX19B antibody was raised using a synthetic peptide corresponding to a region with amino acids GKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG
SLC4A1 antibody
The SLC4A1 antibody is a high-quality reagent used in Life Sciences research. It is a polyclonal antibody that specifically targets the protein SLC4A1, which is found in the extracellular environment. This antibody is widely used in various applications such as immunohistochemistry, western blotting, and flow cytometry. Its high specificity and sensitivity make it an essential tool for studying the function and localization of SLC4A1 in different biological systems. Researchers rely on this antibody to accurately detect and quantify the expression of SLC4A1, enabling them to gain valuable insights into its role in physiological processes and disease mechanisms. Trust the SLC4A1 antibody to deliver reliable results and advance your scientific discoveries.Chymotrypsin antibody
Chymotrypsin antibody was raised in mouse using purified human pancreatic chymotrypsin as the immunogen.PIK3R3 antibody
PIK3R3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE
