Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
HAND1 antibody
HAND1 antibody was raised in Mouse using a purified recombinant fragment of HAND1(aa90-190) expressed in E. coli as the immunogen.
DDX47 antibody
DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQCXCL5 antibody
The CXCL5 antibody is a monoclonal antibody that targets and neutralizes the activity of CXCL5, a growth factor involved in various biological processes. This antibody can be used in life sciences research to study the role of CXCL5 in different cellular functions and pathways. It specifically binds to the receptor binding site of CXCL5, preventing its interaction with target cells and inhibiting downstream signaling events. The CXCL5 antibody has cytotoxic effects on cells that express high levels of CXCL5, making it a potential therapeutic option for diseases associated with abnormal CXCL5 expression. Additionally, this antibody can be used as a tool to detect and quantify CXCL5 levels in biological samples, providing valuable insights into disease progression and treatment efficacy.Met antibody
The Met antibody is a monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor, also known as Met. This antibody has been shown to inhibit the activation of Met by HGF in human serum, making it a potential therapeutic option for diseases associated with aberrant Met signaling. The Met antibody specifically binds to the extracellular domain of the Met receptor, preventing its interaction with HGF and subsequent downstream signaling events. In addition, this antibody has been found to neutralize the activity of autoantibodies that can activate Met in certain diseases. The use of the Met antibody may provide a novel approach for treating conditions such as cancer, where dysregulated Met signaling is often observed.NGAL antibody
The NGAL antibody is a highly specialized binding protein that targets the necrosis factor-related apoptosis-inducing ligand (TRAIL) and alpha-fetoprotein (AFP). Developed by Life Sciences, this monoclonal antibody is designed to specifically bind to these target molecules in human serum. By binding to TRAIL and AFP, the NGAL antibody inhibits their protease activity and prevents their interaction with receptors on cell surfaces.
RBP4 antibody
The RBP4 antibody is a highly activated Monoclonal Antibody that has been specifically designed for use in various Life Sciences applications. It has shown strong reactivity and specificity towards human serum, fibrinogen, mesenchymal stem cells, and circovirus. This antibody is immobilized on an electrode to enable efficient and accurate detection of target molecules in various experimental settings. Additionally, the RBP4 antibody has been proven to be effective in detecting the presence of carbamazepine and ketamine, making it a valuable tool for research and diagnostic purposes. With its exceptional performance and reliability, this monoclonal antibody is a must-have for any laboratory or research facility in need of high-quality antibodies.PAK1 antibody
The PAK1 antibody is a highly specific monoclonal antibody that targets the p21-activated kinase 1 (PAK1) protein. This antibody has been widely used in Life Sciences research to study the role of PAK1 in various cellular processes. It can be used for applications such as Western blotting, immunohistochemistry, and immunofluorescence.Rubisco antibody
Rubisco antibody is a polyclonal antibody that specifically targets the rubisco enzyme. Rubisco, or ribulose-1,5-bisphosphate carboxylase/oxygenase, is an essential enzyme involved in photosynthesis. This antibody can be used in various life science applications to study rubisco and its role in nitrogen metabolism and carbon fixation. It has been shown to have neutralizing activity against rubisco and can inhibit its function. Additionally, this antibody has been used to investigate the effects of imidazolidine derivatives, parathyroid hormone-related peptide, usnic acid, and other compounds on rubisco activity. It may also have potential therapeutic applications as a growth factor or for modulating cytokine production, such as tumor necrosis factor-alpha (TNF-α) or interleukin-6 (IL-6).PPID antibody
PPID antibody was raised using a synthetic peptide corresponding to a region with amino acids CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
CD69 antibody
CD69 antibody was raised in Mouse using a purified recombinant fragment of human CD69 expressed in E. coli as the immunogen.TIRAP antibody
The TIRAP antibody is a highly specialized monoclonal antibody that targets a specific cell antigen found in human serum. This antibody has been extensively researched and developed in the field of Life Sciences. It has been shown to have neutralizing properties against certain androgen-independent cells, making it a potential therapeutic option for various conditions.CD157 antibody
CD157 antibody is a monoclonal antibody that targets β-catenin, interferon, and endothelial growth factor. It acts as a neutralizing agent against these growth factors and inhibitors. This antibody has been extensively studied in the field of life sciences and is commonly used in research and diagnostic applications. CD157 antibody specifically binds to CD157, a cell surface molecule that plays a crucial role in various cellular processes including cell adhesion, migration, and signaling. It can be used as a valuable tool for studying the function of CD157 in different biological systems. Additionally, this antibody can be utilized for testing compounds or evaluating the nuclear localization of specific proteins. With its high specificity and reliability, CD157 antibody is an essential component for any laboratory or research facility working with cellular biology or immunology.Striatin antibody
The Striatin antibody is a polyclonal antibody that specifically targets the protein known as Striatin. This antibody is commonly used in life sciences research, particularly in immunohistochemistry studies. It has been shown to be effective in detecting and quantifying the expression of Striatin in various tissues and cell types.CSDC2 antibody
CSDC2 antibody was raised using the N terminal of CSDC2 corresponding to a region with amino acids MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPSMAD2 antibody
The SMAD2 antibody is a highly specialized antibody used in Life Sciences research. It is specifically designed to target and bind to the SMAD2 protein, which plays a crucial role in cellular signaling pathways. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications.C1ORF116 antibody
C1ORF116 antibody was raised using the middle region of C1Orf116 corresponding to a region with amino acids SGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGKCollagen Type I antibody
The Collagen Type I antibody is a powerful tool for researchers in the Life Sciences field. This monoclonal antibody specifically targets Collagen Type I, a major component of the extracellular matrix. It has been extensively tested and validated for use in various applications.
Renin antibody
Renin antibody is a powerful tool in the field of Life Sciences. It is a neutralizing monoclonal antibody that specifically targets renin, an enzyme involved in the regulation of blood pressure and fluid balance. Renin antibody has been extensively studied for its potential therapeutic applications in hypertension and related cardiovascular disorders.Septin 6 antibody
Septin 6 antibody was raised using the N terminal of 40427 corresponding to a region with amino acids TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIVCCND1 antibody
CCND1 antibody was raised in Mouse using a purified recombinant fragment of human CCND1 expressed in E. coli as the immunogen.TRIML2 antibody
TRIML2 antibody was raised using the middle region of TRIML2 corresponding to a region with amino acids TEMSLIYNFSHCAFQGALRPVFSLCIPNGDTSPDSLTILQHGPSCDATVSMannose 6-Phosphate Receptor antibody
Mannose 6-phosphate receptor antibody was raised in mouse using purified Bovine 300 kDa CI-MPR. as the immunogen.
ZGPAT antibody
ZGPAT antibody was raised using the middle region of ZGPAT corresponding to a region with amino acids LLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSAQSS
p27Kip1 antibody
The p27Kip1 antibody is a highly specialized chemokine that is widely used in Life Sciences research. This antibody targets the alpha-fetoprotein and telomerase, which are key proteins involved in cell growth and division. By binding to these proteins, the p27Kip1 antibody effectively inhibits their activity, leading to a decrease in cell proliferation.IgG antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.FOXRED1 antibody
FOXRED1 antibody was raised using the N terminal of FOXRED1 corresponding to a region with amino acids SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK
RPS4X antibody
The RPS4X antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the sn-38 molecule, which is known for its cytotoxic properties. This antibody has been extensively tested and proven to be highly effective in neutralizing the activity of sn-38.HDAC1 antibody
The HDAC1 antibody is a monoclonal antibody that specifically targets and binds to the histone deacetylase 1 (HDAC1) protein. This antibody is commonly used in life sciences research to study the function and regulation of HDAC1. It can be used for various applications including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The HDAC1 antibody is highly specific and has been validated for use in human hepatocytes. It recognizes both the amino-terminal and carboxyl-terminal regions of HDAC1, making it a versatile tool for studying different aspects of HDAC1 biology. This antibody is biotinylated and can be easily detected using streptavidin-conjugated secondary antibodies. With its high affinity and specificity, the HDAC1 antibody is an essential tool for researchers studying epigenetics, gene expression regulation, and chromatin remodeling.
ACAT2 antibody
ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR6X His tag Antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has been conducted on human erythrocytes using the patch-clamp technique, demonstrating its high frequency of human activity. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their cellADH1B antibody
ADH1B antibody was raised using a synthetic peptide corresponding to a region with amino acids NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV
PLXDC2 antibody
The PLXDC2 antibody is a monoclonal antibody that specifically targets and binds to the PLXDC2 protein. This protein is found on the surface of granulosa cells and plays a crucial role in various biological processes related to growth factor signaling. The PLXDC2 antibody can be used in Life Sciences research to study the function and regulation of this protein.FZD7 antibody
The FZD7 antibody is a powerful tool used in Life Sciences research. It specifically targets the Frizzled-7 receptor, which plays a crucial role in the development and function of catecholaminergic neurons. This antibody is widely used to study the activation and signaling pathways of FZD7 in various cellular processes.ADAT1 antibody
ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFKLHDC8A antibody
KLHDC8A antibody was raised using the C terminal of KLHDC8A corresponding to a region with amino acids PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS
PNKP antibody
PNKP antibody was raised using the N terminal of PNKP corresponding to a region with amino acids MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQJAK1 antibody
The JAK1 antibody is a potent inhibitor that targets pluripotent stem cells. It is a substance that forms an acid complex and can be dissolved in hexane. This antibody has been shown to effectively inhibit cell proliferation by blocking the phosphorylation of peptide nucleic acids. It is widely used in the field of Life Sciences as an activation agent for various applications. Additionally, the JAK1 antibody has shown promising potential as an anticancer agent. Its high-quality production and purity make it a reliable choice for researchers in need of polyclonal antibodies.PPM1B antibody
The PPM1B antibody is a highly specialized monoclonal antibody that has been developed for use in Life Sciences research. It specifically targets and neutralizes the PPM1B protein, which is involved in various cellular processes such as fibrinogen metabolism, helicobacter infection, and peptide nucleic acid synthesis. This antibody has been extensively tested and proven to be highly effective in blocking the activity of PPM1B, making it an essential tool for researchers studying the role of this protein in various biological systems.NDRG1 antibody
NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGFBP1 antibody
FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA
GLRX5 antibody
GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGDonkey anti Mouse IgG (H + L) (Fab'2) (PE)
Donkey anti-mouse IgG (H + L) (Fab'2) (PE) was raised in donkey using mouse IgG (H&L) as the immunogen.Beta actin antibody
The Beta actin antibody is a powerful tool used in the field of Life Sciences for various applications. It specifically targets actin, an essential protein involved in cellular processes such as cell motility, structure, and signaling. This antibody is widely utilized in immunohistochemistry studies to visualize actin distribution and localization within tissues.
