Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
ANKRD2 antibody
ANKRD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLCaspase 8 antibody
The Caspase 8 antibody is a highly effective inhibitor that targets the growth factor superoxide. This monoclonal antibody is designed to specifically neutralize caspase 8, a key enzyme involved in cell death pathways. By blocking the activity of caspase 8, this antibody prevents the initiation of apoptotic processes and promotes cell survival.NRBF2 antibody
NRBF2 antibody was raised using the N terminal of NRBF2 corresponding to a region with amino acids KKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLRBP4 antibody
The RBP4 antibody is a highly specialized antibody that can be used for various applications. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. This antibody specifically targets retinol-binding protein 4 (RBP4), which plays a crucial role in the transport of retinol (vitamin A) in human serum.
SYNCRIP antibody
SYNCRIP antibody was raised using the middle region of SYNCRIP corresponding to a region with amino acids IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGGLGR4 antibody
The LGR4 antibody is a cytotoxic agent that belongs to the family of Life Sciences antibodies. It has shown anti-VEGF (vascular endothelial growth factor) activity and can inhibit the function of tyrosinase, an enzyme involved in melanin production. Additionally, this antibody has neutralizing effects against CD33, a protein expressed on the surface of certain cancer cells. The LGR4 antibody acts as a family kinase inhibitor, blocking the activity of specific kinases involved in cell signaling pathways. It can be used in combination with other antibodies, such as trastuzumab, for targeted cancer therapy. Furthermore, this monoclonal antibody has been shown to have hormone peptide-like properties and can modulate endothelial growth. Its mechanism of action involves binding to specific targets on cells and interfering with their function. The LGR4 antibody may also exhibit anti-inflammatory effects by inhibiting TNF-α (tumor necrosis factor-alpha) production.B3GNT4 antibody
B3GNT4 antibody was raised using the N terminal of B3GNT4 corresponding to a region with amino acids MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLRMKRN1 antibody
The MKRN1 antibody is a highly specialized polypeptide that targets microvessel endothelial cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various biochemical assays. It specifically recognizes and binds to the protein kinase MKRN1, inhibiting its activity and preventing downstream signaling pathways.Septin 9 antibody
Septin 9 antibody was raised using the middle region of SEPT9 corresponding to a region with amino acids VNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYLFTH1 antibody
The FTH1 antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that specifically targets the FTH1 protein, which plays a crucial role in iron metabolism and storage. This antibody is designed to detect and bind to the FTH1 protein with high specificity and sensitivity.ATF2 antibody
The ATF2 antibody is a highly specific and reliable tool for research in the field of Life Sciences. It is a polyclonal antibody that can be used to detect ATF2, a transcription factor involved in various cellular processes. This antibody has been extensively tested and validated for use in applications such as immunohistochemistry, Western blotting, and immunofluorescence.MUC6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.
FOXP3 antibody
FOXP3 antibody was raised in Mouse using a purified recombinant fragment of human FOXP3 expressed in E. coli as the immunogen.TSH α antibody
TSH Alpha antibody was raised in mouse using purified human TSH alpha as the immunogen.GADD153 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its exceptional bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, this active compound inhibits bacterial growth by preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique experiments on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.HDAC2 antibody
The HDAC2 antibody is a powerful tool used in life sciences research. It is commonly used to study the effects of olaparib, ferritin, and other growth factors on cellular processes. This polyclonal antibody has been extensively tested and shown to have neutralizing activity against HDAC2, an important enzyme involved in gene regulation. By blocking the activity of HDAC2, this antibody allows researchers to investigate the role of epigenetic modifications in various biological processes.
SPTLC1 antibody
The SPTLC1 antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used to study the dipeptide substrates and disaccharides involved in sulfate synthesis. This antibody specifically targets the low-density lipoprotein receptor-related protein (LRP), which plays a crucial role in epidermal growth factor signaling. The SPTLC1 antibody has been shown to have a high affinity for LRP, making it an ideal tool for studying its function and regulation.DPH1 antibody
DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEGUSP5 antibody
The USP5 antibody is a highly specific monoclonal antibody that targets the antigen α-syn (alpha-synuclein). It is designed to detect and bind to soluble α-syn in various biological samples. This antibody has been extensively validated and proven to be effective in applications such as immunohistochemistry, western blotting, and ELISA.VDR antibody
The VDR antibody is a powerful tool used in the field of Life Sciences. This antibody is specifically designed to target and bind to the Vitamin D Receptor (VDR), a protein involved in various cellular processes. The VDR antibody has been extensively tested and validated for its high specificity and sensitivity.KAP8.1 antibody
KAP8.1 antibody was raised using the middle region of KRTAP8-1 corresponding to a region with amino acids LCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGCGAECHS1 antibody
ECHS1 antibody was raised using the N terminal of ECHS1 corresponding to a region with amino acids IIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAI
CD55 antibody
The CD55 antibody is a glycopeptide that acts as a neuroprotective agent in the field of Life Sciences. It is a glycoprotein with specific glycan structures that play a crucial role in its function. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their experiments.Caldesmon antibody
Caldesmon antibody is a highly specific monoclonal antibody that targets caldesmon, a protein involved in smooth muscle contraction. This antibody has been widely used in various applications within the Life Sciences field. It can be used for research purposes, such as studying the expression and localization of caldesmon in different tissues and cell types. Additionally, this monoclonal antibody has neutralizing properties and can inhibit the activity of caldesmon, making it a valuable tool for investigating the functional role of this protein.p53 antibody
The p53 antibody is an essential tool for researchers in the field of life sciences. It is a highly specific antibody that targets the phosphatase protein p53. This protein plays a crucial role in regulating cell growth and preventing tumor formation. The p53 antibody can be used to study various cellular processes, including apoptosis, DNA repair, and cell cycle arrest.
NFKB1 antibody
The NFKB1 antibody is a highly specialized protein that belongs to the Life Sciences category. It is a monoclonal antibody that specifically targets and interacts with the NFKB1 protein. This antibody has been extensively studied and proven to be effective in various research applications.Rubella virus antibody (FITC)
Rubella virus antibody (FITC) was raised in goat using Rubeola strain HPV77 as the immunogen.
Cathepsin D antibody
The Cathepsin D antibody is a highly effective polyclonal antibody that is used in the field of life sciences. It acts as a CDK4/6 inhibitor and has been shown to inhibit p38 MAPK activation. This antibody is derived from human serum and contains excipients that enhance its stability and effectiveness. The Cathepsin D antibody specifically targets adipose tissue and globulin, making it an ideal tool for studying factors involved in adipose metabolism. Additionally, this antibody has anti-VEGF properties, neutralizing the activity of vascular endothelial growth factor (VEGF), a key regulator of angiogenesis. Its monoclonal nature ensures high specificity and reliability in experimental studies. With its ability to bind to specific acid residues, the Cathepsin D antibody can effectively block the activity of growth factors, providing valuable insights into cellular processes related to growth and development.Connexin 43 antibody
The Connexin 43 antibody is a polyclonal antibody that is used in the field of Life Sciences. It specifically targets Connexin 43, a protein that plays a crucial role in cell communication. This antibody can be used to study the function and localization of Connexin 43 in various biological systems.Ret antibody
Ret antibody was raised in Mouse using a purified recombinant fragment of Ret (aa896-1063) expressed in E. coli as the immunogen.RNF39 antibody
RNF39 antibody was raised using the C terminal of RNF39 corresponding to a region with amino acids CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVLDUS1L antibody
DUS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF
FYTTD1 antibody
FYTTD1 antibody was raised in rabbit using the middle region of FYTTD1 as the immunogenNARG1 antibody
NARG1 antibody was raised in mouse using recombinant Human Nmda Receptor Regulated 1 (Narg1)CD51 antibody
The CD51 antibody is a highly specific monoclonal antibody that can be used for ultrasensitive detection of protease activity. It is commonly used in Life Sciences research, particularly in flow immunoassays and electrode-based assays. This antibody binds to CD51, a surface protein expressed on human cells, and neutralizes its function. The CD51 antibody has been extensively validated and shown to provide accurate and reliable results in various experimental settings. Its high affinity and specificity make it an ideal tool for studying protease activity and its role in various biological processes. Additionally, the CD51 antibody can be easily modified for surface immobilization using techniques such as collagenase treatment or surface modification for electrochemical impedance spectroscopy. With its exceptional sensitivity and versatility, the CD51 antibody is a valuable asset in any research laboratory seeking to investigate protease activity with precision and accuracy.IL1F10 antibody
IL1F10 antibody was raised in rabbit using the middle region of IL1F10 as the immunogenGRIK2 antibody
GRIK2 antibody was raised using the N terminal of GRIK2 corresponding to a region with amino acids LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPIRF3 antibody
The IRF3 antibody is a highly specialized monoclonal antibody used in Life Sciences. It is specifically designed to target and bind to the nuclear protein IRF3, which plays a crucial role in regulating the immune response. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications.alpha 2 Antiplasmin antibody (HRP)
alpha 2 Antiplasmin antibody (HRP) was raised in goat using human alpha 2 Antiplasmin purified from plasma as the immunogen.TRAF1 antibody
The TRAF1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets the tumor necrosis factor receptor-associated factor 1 (TRAF1), which plays a crucial role in various cellular processes, including insulin and epidermal growth factor signaling pathways. This antibody can be used for research purposes to study the function and regulation of TRAF1.Smad2 antibody
The Smad2 antibody is a highly specialized product in the field of Life Sciences. It is designed to specifically target and bind to activated Smad2, a key protein involved in cardiomyocyte function. This antibody can be used in various research applications, including the study of cardiac development, signaling pathways, and disease mechanisms.SYT13 antibody
The SYT13 antibody is an essential tool in Life Sciences research. It is an antibody that specifically targets and binds to SYT13, a glycoprotein involved in various cellular processes. This antibody has been extensively tested and characterized for its specificity, sensitivity, and neutralizing properties.CYP3A7 antibody
CYP3A7 antibody was raised using the middle region of CYP3A7 corresponding to a region with amino acids KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSIFGF21 antibody
The FGF21 antibody is a monoclonal antibody that specifically targets and binds to fibroblast growth factor 21 (FGF21). FGF21 is a growth factor that plays a crucial role in regulating various metabolic processes, including glucose and lipid metabolism. The FGF21 antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to metabolic disorders.
