Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Gpr88 antibody
Gpr88 antibody was raised in rabbit using the C terminal of Gpr88 as the immunogenDegré de pureté :Min. 95%E2F8 antibody
E2F8 antibody was raised in rabbit using the middle region of E2F8 as the immunogenDegré de pureté :Min. 95%LONRF2 antibody
LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids IGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQSVDegré de pureté :Min. 95%TUT1 antibody
TUT1 antibody was raised in rabbit using the N terminal of TUT1 as the immunogenDegré de pureté :Min. 95%MAPK6 antibody
MAPK6 antibody was raised in rabbit using the middle region of MAPK6 as the immunogen
Degré de pureté :Min. 95%CYP20A1 antibody
CYP20A1 antibody was raised using the N terminal of CYP20A1 corresponding to a region with amino acids ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDegré de pureté :Min. 95%SMYD5 antibody
SMYD5 antibody was raised in rabbit using the C terminal of SMYD5 as the immunogenDegré de pureté :Min. 95%GRK7 antibody
GRK7 antibody was raised in rabbit using the C terminal of GRK7 as the immunogen
Degré de pureté :Min. 95%BIN2 antibody
BIN2 antibody was raised in rabbit using the middle region of BIN2 as the immunogenDegré de pureté :Min. 95%ZDHHC19 antibody
ZDHHC19 antibody was raised using the middle region of ZDHHC19 corresponding to a region with amino acids AAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFDQGCASNWYLTDegré de pureté :Min. 95%Human Albumin antibody
Human Albumin antibody was raised against Human Albumin.Degré de pureté :Min. 95%Vaspin antibody
Vaspin antibody was raised in rabbit using highly pure recombinant human vaspin as the immunogen.Degré de pureté :Min. 95%GPD2 antibody
GPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGGDegré de pureté :Min. 95%CRISPLD2 antibody
CRISPLD2 antibody was raised using the N terminal of CRISPLD2 corresponding to a region with amino acids MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRADegré de pureté :Min. 95%PREB antibody
PREB antibody was raised in rabbit using the N terminal of PREB as the immunogenDegré de pureté :Min. 95%PYHIN1 antibody
PYHIN1 antibody was raised in rabbit using the N terminal of PYHIN1 as the immunogenDegré de pureté :Min. 95%KCNQ2 antibody
KCNQ2 antibody was raised using the N terminal of KCNQ2 corresponding to a region with amino acids IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLDegré de pureté :Min. 95%TRAPPC4 antibody
TRAPPC4 antibody was raised using the middle region of TRAPPC4 corresponding to a region with amino acids EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVDegré de pureté :Min. 95%SP1 antibody
The SP1 antibody is a monoclonal antibody that is commonly used in Life Sciences research. It specifically targets and binds to the SP1 protein, which is a transcription factor involved in regulating gene expression. This antibody has been extensively studied and validated for its specificity and sensitivity in detecting SP1 protein in various experimental settings.Degré de pureté :Min. 95%MPG antibody
MPG antibody was raised using the C terminal of MPG corresponding to a region with amino acids LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQADegré de pureté :Min. 95%Atp5f1 antibody
Atp5f1 antibody was raised in rabbit using the N terminal of Atp5f1 as the immunogenDegré de pureté :Min. 95%DNAJC10 antibody
DNAJC10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYDegré de pureté :Min. 95%KRT3 antibody
KRT3 antibody was raised in rabbit using the C terminal of KRT3 as the immunogenDegré de pureté :Min. 95%YWHAB antibody
YWHAB antibody was raised in rabbit using the middle region of YWHAB as the immunogenDegré de pureté :Min. 95%NF kappaB p65 antibody
The NF kappaB p65 antibody is a highly effective tool used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody specifically targets the NF kappaB p65 protein, which plays a crucial role in various cellular processes.Degré de pureté :Min. 95%TRIM59 antibody
TRIM59 antibody was raised using the N terminal of TRIM59 corresponding to a region with amino acids RIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHDegré de pureté :Min. 95%Zfy2 antibody
Zfy2 antibody was raised in rabbit using the middle region of Zfy2 as the immunogenDegré de pureté :Min. 95%CDH4 antibody
CDH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids RIISGDPSGHFSVRTDPVTNEGMVTVVKAVDYELNRAFMLTVMVSNQAPL
Degré de pureté :Min. 95%MAGEA9 antibody
MAGEA9 antibody was raised in rabbit using the middle region of MAGEA9 as the immunogenDegré de pureté :Min. 95%SLC5A5 antibody
SLC5A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSEQTMRVLPSSAARCVALSVNASGLLDPALLPANDSSRAPSSGMDASRPDegré de pureté :Min. 95%ANAPC10 antibody
ANAPC10 antibody was raised using the N terminal of ANAPC10 corresponding to a region with amino acids MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLDegré de pureté :Min. 95%HNMT antibody
HNMT antibody was raised in rabbit using the N terminal of HNMT as the immunogen
Degré de pureté :Min. 95%IZUMO1 antibody
IZUMO1 antibody was raised using the C terminal of IZUMO1 corresponding to a region with amino acids SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQDegré de pureté :Min. 95%SLC22A15 antibody
SLC22A15 antibody was raised using the middle region of SLC22A15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGKDegré de pureté :Min. 95%ZNF570 antibody
ZNF570 antibody was raised in rabbit using the N terminal of ZNF570 as the immunogenDegré de pureté :Min. 95%ZRANB1 antibody
ZRANB1 antibody was raised in rabbit using the C terminal of ZRANB1 as the immunogenDegré de pureté :Min. 95%MUC1 antibody
MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids GCAGHCLSHCLGCLSVPPKELRAAGHLSSPGYLPSYERVPHLPHPWALCA
Degré de pureté :Min. 95%TMTC1 antibody
TMTC1 antibody was raised using the middle region of TMTC1 corresponding to a region with amino acids GPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLVDegré de pureté :Min. 95%ZDHHC24 antibody
ZDHHC24 antibody was raised using the N terminal of ZDHHC24 corresponding to a region with amino acids YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVMLDegré de pureté :Min. 95%MDS032 antibody
MDS032 antibody was raised in rabbit using the N terminal of MDS032 as the immunogenDegré de pureté :Min. 95%ST3GAL3 antibody
ST3GAL3 antibody was raised using the N terminal of ST3GAL3 corresponding to a region with amino acids MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKDegré de pureté :Min. 95%SNRPN antibody
SNRPN antibody was raised in rabbit using the N terminal of SNRPN as the immunogenDegré de pureté :Min. 95%BCKDHA antibody
BCKDHA antibody was raised using the N terminal of BCKDHA corresponding to a region with amino acids NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYDegré de pureté :Min. 95%AFM antibody
AFM antibody was raised in rabbit using the C terminal of AFM as the immunogenDegré de pureté :Min. 95%PHYH antibody
PHYH antibody was raised in rabbit using the N terminal of PHYH as the immunogenDegré de pureté :Min. 95%MAPK1 antibody
MAPK1 antibody was raised in rabbit using the middle region of MAPK1 as the immunogenDegré de pureté :Min. 95%BTG4 antibody
BTG4 antibody was raised using the middle region of BTG4 corresponding to a region with amino acids ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRDegré de pureté :Min. 95%SLC6A5 antibody
SLC6A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEDegré de pureté :Min. 95%HLTF antibody
HLTF antibody was raised in rabbit using the N terminal of HLTF as the immunogen
Degré de pureté :Min. 95%AVPR2 antibody
AVPR2 antibody was raised in rabbit using the C terminal of AVPR2 as the immunogenDegré de pureté :Min. 95%TMTC4 antibody
TMTC4 antibody was raised using the N terminal of TMTC4 corresponding to a region with amino acids NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGFDegré de pureté :Min. 95%SLC4A2 antibody
SLC4A2 antibody was raised using the N terminal of SLC4A2 corresponding to a region with amino acids MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEIDegré de pureté :Min. 95%Merlin antibody
The Merlin antibody is a potent antiviral agent that belongs to the class of polyclonal antibodies. It has been extensively studied in Life Sciences and has shown remarkable efficacy in neutralizing various viruses. The antibody specifically targets activated fibrinogen, which plays a crucial role in viral replication and spread. By binding to fibrinogen, the Merlin antibody inhibits its interaction with viral proteins, thereby preventing viral entry into host cells. Additionally, this antibody has been found to modulate chemokine signaling pathways and inhibit protein kinase activity, further enhancing its antiviral effects. Mass spectrometric methods have been used to characterize the structure and composition of the Merlin antibody, confirming its specificity and potency. Clinical studies have demonstrated that this antibody can effectively inhibit viral replication and reduce viral load in infected individuals. With its broad-spectrum antiviral activity and high neutralizing capacity, the Merlin antibody holds great promise for the development of novel therapeutic strategies against viral infections.Degré de pureté :Min. 95%NEDD9 antibody
NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids DLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTADegré de pureté :Min. 95%Synpr antibody
Synpr antibody was raised in rabbit using the middle region of Synpr as the immunogenDegré de pureté :Min. 95%LEMD2 antibody
LEMD2 antibody was raised using the middle region of LEMD2 corresponding to a region with amino acids SRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSEDegré de pureté :Min. 95%CNTF antibody
CNTF antibody was raised in rabbit using highly pure recombinant rat CNTF as the immunogen.Degré de pureté :Min. 95%DNAJC1 antibody
DNAJC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALTRTDegré de pureté :Min. 95%Glycoprotein antibody
Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids KGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEDegré de pureté :Min. 95%ADORA3 antibody
ADORA3 antibody was raised in rabbit using the C terminal of ADORA3 as the immunogen
Degré de pureté :Min. 95%9030625A04Rik antibody
9030625A04Rik antibody was raised in rabbit using the C terminal of 9030625A04Rik as the immunogenDegré de pureté :Min. 95%CLEC4M antibody
CLEC4M antibody was raised in rabbit using the middle region of CLEC4M as the immunogenDegré de pureté :Min. 95%DENTT antibody
DENTT antibody was raised in rabbit using residues 489-503 [NNETTDNNESADDHE] of the human DENTT protein as the immunogen.Degré de pureté :Min. 95%Septin 12 antibody
Septin 12 antibody was raised using the middle region of 40433 corresponding to a region with amino acids LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFDDegré de pureté :Min. 95%Dopamine Receptor 2 antibody
Dopamine receptor 2 antibody was raised in rabbit using a 13 amino acid peptide of rat D1R as the immunogen.Degré de pureté :Min. 95%AMZ2 antibody
AMZ2 antibody was raised in rabbit using the C terminal of AMZ2 as the immunogenDegré de pureté :Min. 95%Haptoglobin antibody
Haptoglobin antibody was raised against Human Haptoglobin.Degré de pureté :Min. 95%PLA2G4B antibody
PLA2G4B antibody was raised in rabbit using the N terminal of PLA2G4B as the immunogenDegré de pureté :Min. 95%PCSK5 antibody
PCSK5 antibody was raised using the middle region of PCSK5 corresponding to a region with amino acids CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDISDegré de pureté :Min. 95%UBXD3 antibody
UBXD3 antibody was raised using the middle region of UBXD3 corresponding to a region with amino acids PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSIDegré de pureté :Min. 95%ZNF554 antibody
ZNF554 antibody was raised in rabbit using the N terminal of ZNF554 as the immunogenDegré de pureté :Min. 95%RAP1GDS1 antibody
RAP1GDS1 antibody was raised in rabbit using the middle region of RAP1GDS1 as the immunogenDegré de pureté :Min. 95%PCDH8 antibody
PCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids RVFRALLVISDGGRPPLTTTATVSFVVTAGGGRGPAAPASAGSPERSRPPDegré de pureté :Min. 95%ABCF3 antibody
ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL
Degré de pureté :Min. 95%NR2E1 antibody
NR2E1 antibody was raised using the middle region of NR2E1 corresponding to a region with amino acids LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLDegré de pureté :Min. 95%KLHDC5 antibody
KLHDC5 antibody was raised in rabbit using the N terminal of KLHDC5 as the immunogenDegré de pureté :Min. 95%PRKAA1 antibody
PRKAA1 antibody was raised using the middle region of PRKAA1 corresponding to a region with amino acids SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDegré de pureté :Min. 95%IL28R α antibody
IL28R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVDegré de pureté :Min. 95%OMG antibody
OMG antibody was raised using the N terminal of OMG corresponding to a region with amino acids ANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNDegré de pureté :Min. 95%ESDN antibody
ESDN antibody was raised in rabbit using residues 399-416 [QDKIFQGNKDYHKDVRNN] of the human ESDN protein as the immunogen.Degré de pureté :Min. 95%VGF antibody
VGF antibody was raised using the middle region of VGF corresponding to a region with amino acids VRSPQPPPPAPAPARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRP
Degré de pureté :Min. 95%RNF185 antibody
RNF185 antibody was raised using the middle region of RNF185 corresponding to a region with amino acids QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFDegré de pureté :Min. 95%TM9SF1 antibody
TM9SF1 antibody was raised using the N terminal of TM9SF1 corresponding to a region with amino acids YMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRDegré de pureté :Min. 95%Lpcat2 antibody
Lpcat2 antibody was raised in rabbit using the C terminal of Lpcat2 as the immunogenDegré de pureté :Min. 95%Hps3 antibody
Hps3 antibody was raised in rabbit using the N terminal of Hps3 as the immunogenDegré de pureté :Min. 95%TMCO3 antibody
TMCO3 antibody was raised using the N terminal of TMCO3 corresponding to a region with amino acids KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRALDegré de pureté :Min. 95%DHRS9 antibody
DHRS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVDegré de pureté :Min. 95%ZNF460 antibody
ZNF460 antibody was raised in rabbit using the N terminal of ZNF460 as the immunogenDegré de pureté :Min. 95%CD40 antibody
CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDDegré de pureté :Min. 95%LTB4R antibody
LTB4R antibody was raised in rabbit using the C terminal of LTB4R as the immunogen
Degré de pureté :Min. 95%TOX antibody
TOX antibody was raised in rabbit using the N terminal of TOX as the immunogen
Degré de pureté :Min. 95%ALG6 antibody
ALG6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLIDegré de pureté :Min. 95%FSCN3 antibody
FSCN3 antibody was raised in rabbit using the C terminal of FSCN3 as the immunogenDegré de pureté :Min. 95%MCTP1 antibody
MCTP1 antibody was raised using the middle region of MCTP1 corresponding to a region with amino acids EVTVYDEDRDRSADFLGKVAIPLLSIQNGEQKAYVLKNKQLTGPTKGVIYDegré de pureté :Min. 95%Protein C antibody
Protein C antibody was raised using a synthetic peptide corresponding to a region with amino acids PCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLD
Degré de pureté :Min. 95%
