Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
ZDHHC16 antibody
ZDHHC16 antibody was raised using the C terminal of ZDHHC16 corresponding to a region with amino acids VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGDegré de pureté :Min. 95%MAP3K2 antibody
MAP3K2 antibody was raised using the N terminal of MAP3K2 corresponding to a region with amino acids AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPEDegré de pureté :Min. 95%CYP3A4 antibody
CYP3A4 antibody was raised using the middle region of CYP3A4 corresponding to a region with amino acids MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGDegré de pureté :Min. 95%HS3ST3B1 antibody
HS3ST3B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPRDegré de pureté :Min. 95%ATF4 antibody
The ATF4 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and neutralizes the activity of ATF4, a transcription factor that plays a crucial role in cellular responses to stress and growth factor signaling. This antibody is designed to bind to ATF4 dimers, preventing their interaction with DNA and inhibiting the expression of target genes involved in processes such as collagen synthesis and hepatocyte growth. The ATF4 antibody is widely used in various applications, including immunohistochemistry, Western blotting, and chromatin immunoprecipitation. With its high specificity and cytotoxic properties, this antibody is an essential tool for studying the molecular mechanisms underlying cellular stress responses and identifying potential therapeutic targets for various diseases.
Degré de pureté :Min. 95%GNAS antibody
GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDDegré de pureté :Min. 95%IL28R alpha antibody
IL28R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFDegré de pureté :Min. 95%HMGB4 antibody
HMGB4 antibody was raised in rabbit using the C terminal of HMGB4 as the immunogenDegré de pureté :Min. 95%ZNF641 antibody
ZNF641 antibody was raised in rabbit using the middle region of ZNF641 as the immunogenDegré de pureté :Min. 95%ING4 antibody
ING4 antibody was raised in rabbit using the middle region of ING4 as the immunogenDegré de pureté :Min. 95%ANGPT4 antibody
ANGPT4 antibody was raised using the N terminal of ANGPT4 corresponding to a region with amino acids TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT
Degré de pureté :Min. 95%IL4 antibody
IL4 antibody was raised in rabbit using highly pure recombinant rat IL-4 as the immunogen.Degré de pureté :Min. 95%APOL5 antibody
APOL5 antibody was raised in rabbit using the C terminal of APOL5 as the immunogenDegré de pureté :Min. 95%EHD1 antibody
EHD1 antibody was raised in rabbit using the middle region of EHD1 as the immunogenDegré de pureté :Min. 95%XK antibody
XK antibody was raised using a synthetic peptide corresponding to a region with amino acids LHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEDegré de pureté :Min. 95%EXOC4 antibody
EXOC4 antibody was raised in rabbit using the N terminal of EXOC4 as the immunogenDegré de pureté :Min. 95%CYP1A1 antibody
CYP1A1 antibody was raised using the middle region of CYP1A1 corresponding to a region with amino acids QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV
Degré de pureté :Min. 95%Park2 antibody
Park2 antibody was raised in rabbit using the C terminal of Park2 as the immunogenDegré de pureté :Min. 95%mGluR2/3 antibody
mGluR2/3 antibody was raised in rabbit using residues 860-872 [NGREVVDSTTSSL] of the rat mGlurR2/3 protein as the immunogen.Degré de pureté :Min. 95%NPY1R antibody
NPY1R antibody was raised in rabbit using a 15 amino acid peptide from mouse NPY1R as the immunogen.Degré de pureté :Min. 95%ECT2 antibody
ECT2 antibody was raised using the middle region of ECT2 corresponding to a region with amino acids PECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSLDegré de pureté :Min. 95%LRRC25 antibody
LRRC25 antibody was raised using the N terminal of LRRC25 corresponding to a region with amino acids AEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQDegré de pureté :Min. 95%NPM2 antibody
NPM2 antibody was raised using the N terminal of NPM2 corresponding to a region with amino acids LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQADegré de pureté :Min. 95%NOV antibody
NOV antibody was raised in rabbit using highly pure recombinant human NOV as the immunogen.Degré de pureté :Min. 95%SLC25A11 antibody
SLC25A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMDegré de pureté :Min. 95%VTN antibody
VTN antibody was raised in rabbit using the N terminal of VTN as the immunogenDegré de pureté :Min. 95%LIGHT antibody
LIGHT antibody was raised in rabbit using highly pure recombinant human LIGHT as the immunogen.
Degré de pureté :Min. 95%Ap3b1 antibody
Ap3b1 antibody was raised in rabbit using the N terminal of Ap3b1 as the immunogenDegré de pureté :Min. 95%AURKA antibody
AURKA antibody was raised in rabbit using the C terminal of AURKA as the immunogenDegré de pureté :Min. 95%HS2ST1 antibody
HS2ST1 antibody was raised using the middle region of HS2ST1 corresponding to a region with amino acids GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTIDegré de pureté :Min. 95%RDH16 antibody
RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids WLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDADegré de pureté :Min. 95%IGSF9 antibody
IGSF9 antibody was raised using the N terminal of IGSF9 corresponding to a region with amino acids SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA
Degré de pureté :Min. 95%FCN1 antibody
FCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEADegré de pureté :Min. 95%NFATc2 antibody
NFATc2 antibody was raised in rabbit using residues 269-281 [ASPQRSRSPSPQP] of the human NFATc2 protein as the immunogen.Degré de pureté :Min. 95%IRF4 antibody
The IRF4 antibody is a polyclonal antibody used in the field of Life Sciences. It is designed to target and bind to the Interferon Regulatory Factor 4 (IRF4), a protein involved in various cellular processes. This antibody is commonly used in research to study the role of IRF4 in different biological systems.Degré de pureté :Min. 95%OAS2 antibody
OAS2 antibody was raised using the N terminal of OAS2 corresponding to a region with amino acids DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDLDegré de pureté :Min. 95%LOC731673 antibody
LOC731673 antibody was raised in rabbit using the C terminal of LOC731673 as the immunogen
Degré de pureté :Min. 95%RRAD antibody
RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG
Degré de pureté :Min. 95%SIDT2 antibody
SIDT2 antibody was raised using the N terminal of SIDT2 corresponding to a region with amino acids LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPTDegré de pureté :Min. 95%ST3GAL4 antibody
ST3GAL4 antibody was raised using the middle region of ST3GAL4 corresponding to a region with amino acids FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVDegré de pureté :Min. 95%SLC43A2 antibody
SLC43A2 antibody was raised using the N terminal of SLC43A2 corresponding to a region with amino acids TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLSDegré de pureté :Min. 95%MOSPD2 antibody
MOSPD2 antibody was raised using the middle region of MOSPD2 corresponding to a region with amino acids TPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTESTDegré de pureté :Min. 95%NOMO1 antibody
NOMO1 antibody was raised using the C terminal of NOMO1 corresponding to a region with amino acids QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASDDegré de pureté :Min. 95%ZNF791 antibody
ZNF791 antibody was raised in rabbit using the middle region of ZNF791 as the immunogenDegré de pureté :Min. 95%CADM3 antibody
CADM3 antibody was raised in rabbit using the middle region of CADM3 as the immunogenDegré de pureté :Min. 95%HSZFP36 antibody
HSZFP36 antibody was raised in rabbit using the middle region of HSZFP36 as the immunogenDegré de pureté :Min. 95%RBM5 antibody
RBM5 antibody was raised in rabbit using the N terminal of RBM5 as the immunogenDegré de pureté :Min. 95%SLC20A2 antibody
SLC20A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGFDegré de pureté :Min. 95%Upp2 antibody
Upp2 antibody was raised in rabbit using the C terminal of Upp2 as the immunogenDegré de pureté :Min. 95%TANK antibody
TANK antibody was raised in rabbit using the C terminal of TANK as the immunogenDegré de pureté :Min. 95%SLC25A16 antibody
SLC25A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRDegré de pureté :Min. 95%CCL16 antibody
CCL16 antibody was raised in rabbit using the N terminal of CCL16 as the immunogenDegré de pureté :Min. 95%NFKBIE antibody
NFKBIE antibody was raised in rabbit using the middle region of NFKBIE as the immunogenDegré de pureté :Min. 95%ACVR2B antibody
ACVR2B antibody was raised using the middle region of ACVR2B corresponding to a region with amino acids LCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVDegré de pureté :Min. 95%ALOX15B antibody
ALOX15B antibody was raised in rabbit using the middle region of ALOX15B as the immunogenDegré de pureté :Min. 95%MEIS3 antibody
MEIS3 antibody was raised in rabbit using the middle region of MEIS3 as the immunogenDegré de pureté :Min. 95%HADH antibody
HADH antibody was raised in rabbit using the middle region of HADH as the immunogenDegré de pureté :Min. 95%Transferrin antibody (Prediluted for IHC)
Rabbit polyclonal Transferrin antibodyDegré de pureté :Min. 95%LRRC8B antibody
LRRC8B antibody was raised using the N terminal of LRRC8B corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS
Degré de pureté :Min. 95%MCP3 antibody
MCP3 antibody was raised in goat using highly pure recombinant murine MCP-3 as the immunogen.Degré de pureté :Min. 95%Slc22a3 antibody
Slc22a3 antibody was raised in rabbit using the middle region of Slc22a3 as the immunogenDegré de pureté :Min. 95%ApoA-IV antibody
ApoA-IV antibody was raised using the C terminal of APOA4 corresponding to a region with amino acids RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQDegré de pureté :Min. 95%ERK1 antibody
The ERK1 antibody is a highly specialized antibody that is used for the detection and analysis of activated ERK1 protein. This antibody has been extensively tested and validated for its specificity and sensitivity in various research applications. It is commonly used in studies involving ginseng, botulinum, histidine protein, and other related fields.
Degré de pureté :Min. 95%USP9Y antibody
USP9Y antibody was raised in rabbit using the C terminal of USP9Y as the immunogenDegré de pureté :Min. 95%RASL12 antibody
RASL12 antibody was raised using the N terminal of RASL12 corresponding to a region with amino acids MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYDDegré de pureté :Min. 95%Claudin 7 antibody
Claudin 7 antibody was raised using the C terminal of CLDN7 corresponding to a region with amino acids GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYVDegré de pureté :Min. 95%TBL1Y antibody
TBL1Y antibody was raised in rabbit using the middle region of TBL1Y as the immunogen
Degré de pureté :Min. 95%RAD1 antibody
RAD1 antibody was raised in rabbit using the middle region of RAD1 as the immunogenDegré de pureté :Min. 95%Thymopoietin antibody
Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPDegré de pureté :Min. 95%PTCH1 antibody
PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAMDegré de pureté :Min. 95%PTDSR antibody
PTDSR antibody was raised in rabbit using the middle region of PTDSR as the immunogenDegré de pureté :Min. 95%ZDHHC16 antibody
ZDHHC16 antibody was raised using the N terminal of ZDHHC16 corresponding to a region with amino acids SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKCDegré de pureté :Min. 95%GABRE antibody
GABRE antibody was raised using a synthetic peptide corresponding to a region with amino acids DVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHDegré de pureté :Min. 95%LENG4 antibody
LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAADegré de pureté :Min. 95%ZNF625 antibody
ZNF625 antibody was raised in rabbit using the N terminal of ZNF625 as the immunogenDegré de pureté :Min. 95%M-CSF antibody
M-CSF antibody was raised in goat using highly pure recombinant murine M-CSF as the immunogen.Degré de pureté :Min. 95%LRRTM4 antibody
LRRTM4 antibody was raised using the middle region of LRRTM4 corresponding to a region with amino acids FYWLKNFKGNKESTMICAGPKHIQGEKVSDAVETYNICSEVQVVNTERSHDegré de pureté :Min. 95%SLC15A3 antibody
The SLC15A3 antibody is a highly versatile and effective tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the SLC15A3 protein isoforms. This antibody can be used in various applications such as immunohistochemistry, immunofluorescence, and Western blotting.Degré de pureté :Min. 95%CASD1 antibody
CASD1 antibody was raised using the N terminal of CASD1 corresponding to a region with amino acids MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCEDegré de pureté :Min. 95%CYP24A1 antibody
CYP24A1 antibody was raised in rabbit using the C terminal of CYP24A1 as the immunogenDegré de pureté :Min. 95%DACH2 antibody
DACH2 antibody was raised in rabbit using the C terminal of DACH2 as the immunogenDegré de pureté :Min. 95%Harbi1 antibody
Harbi1 antibody was raised in rabbit using the N terminal of Harbi1 as the immunogenDegré de pureté :Min. 95%CD40L antibody
CD40L antibody was raised in goat using highly pure recombinant human sCD40L as the immunogen.Degré de pureté :Min. 95%C14orf28 antibody
C14orf28 antibody was raised in rabbit using the middle region of C14orf28 as the immunogen
Degré de pureté :Min. 95%KIF3A antibody
KIF3A antibody was raised using the C terminal of KIF3A corresponding to a region with amino acids PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRDegré de pureté :Min. 95%SNAI1 antibody
SNAI1 antibody was raised in rabbit using the N terminal of SNAI1 as the immunogenDegré de pureté :Min. 95%GRLF1 antibody
GRLF1 antibody was raised in rabbit using the N terminal of GRLF1 as the immunogen
Degré de pureté :Min. 95%ZFP3 antibody
ZFP3 antibody was raised in rabbit using the N terminal of ZFP3 as the immunogenDegré de pureté :Min. 95%Abra antibody
Abra antibody was raised in rabbit using the C terminal of Abra as the immunogenDegré de pureté :Min. 95%Pannexin 1 antibody
Pannexin 1 antibody was raised using the middle region of PANX1 corresponding to a region with amino acids LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINDegré de pureté :Min. 95%CA5A antibody
CA5A antibody was raised in rabbit using the C terminal of CA5A as the immunogenDegré de pureté :Min. 95%ZNF570 antibody
ZNF570 antibody was raised in rabbit using the middle region of ZNF570 as the immunogenDegré de pureté :Min. 95%CLCNKB antibody
CLCNKB antibody was raised using the C terminal of CLCNKB corresponding to a region with amino acids ILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSWDegré de pureté :Min. 95%ZMPSTE24 antibody
ZMPSTE24 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLDegré de pureté :Min. 95%FRK antibody
FRK antibody was raised using the N terminal of FRK corresponding to a region with amino acids LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARHDegré de pureté :Min. 95%BIK antibody
The BIK antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of BIK, a protein involved in regulating cell death. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. It has been shown to inhibit the activity of BIK, preventing its interaction with other proteins and ultimately leading to a reduction in cell death. Additionally, the BIK antibody has been found to have neutralizing effects on reactive oxygen species, which are known to contribute to inflammation and tissue damage. This antibody can be used in a variety of applications, including studies involving human serum, interleukin-6, mesenchymal stem cells, and influenza hemagglutinin. Whether you're conducting cutting-edge research or developing innovative therapies, the BIK antibody is an invaluable tool for your scientific endeavors.Degré de pureté :Min. 95%FBG2 antibody
FBG2 antibody was raised in rabbit using residues 268-284 (SEAQPGQKHGQEEAAQS) of the human FBG2 protein as the immunogen.Degré de pureté :Min. 95%GDNF antibody
GDNF antibody was raised in rabbit using highly pure recombinant human GDNF as the immunogen.Degré de pureté :Min. 95%ITIH1 antibody
ITIH1 antibody was raised in rabbit using the C terminal of ITIH1 as the immunogenDegré de pureté :Min. 95%
