Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
NOC3L antibody
NOC3L antibody was raised using a synthetic peptide corresponding to a region with amino acids TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEEALFBXO39 antibody
FBXO39 antibody was raised using the N terminal of FBXO39 corresponding to a region with amino acids DRSRAALVCRKWNQMMYSAELWRYRTITFSGRPSRVHASEVESAVWYVKKNRCAM antibody
NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP
HYLS1 antibody
HYLS1 antibody was raised using the middle region of HYLS1 corresponding to a region with amino acids YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYLIER5L antibody
IER5L antibody was raised using the middle region of IER5L corresponding to a region with amino acids SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA
PROCA1 antibody
PROCA1 antibody was raised using the middle region of PROCA1 corresponding to a region with amino acids GELSSEDIVESSSPRKRENTVQAKKTGAKPSQARKVNKRKSPPGSNPNLSRBPMS antibody
RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQFOXO4 antibody
The FOXO4 antibody is a highly specialized substance that belongs to the group of antibodies. It is specifically designed to target and bind to the FOXO4 protein, which plays a crucial role in pluripotent stem cells. This antibody can be used in various research applications, including immunohistochemical staining and affinity ligand purification.Lipase antibody (Pancreatic)
Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVYBX1 antibody
The YBX1 antibody is a highly specialized monoclonal antibody that targets the growth factor YBX1. It is designed for immobilization on electrodes and is commonly used in electrochemical impedance studies. This antibody has been extensively tested and proven to effectively detect and measure YBX1 levels in various samples, including human serum. It can also be used to detect autoantibodies against YBX1.
GRK5 antibody
The GRK5 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets and binds to the activated form of the GRK5 protein. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity.WDSOF1 antibody
WDSOF1 antibody was raised using the N terminal of WDSOF1 corresponding to a region with amino acids WSPAGRATEMKVKMLSRNPDNYVRETKLDLQRVPRNYDPALHPFEVPREYCoronavirus Antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. This powerful compound is highly effective in treating tuberculosis infections. It works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Its bactericidal activity has been extensively studied using advanced techniques such as patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. It also specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
MKRN1 antibody
MKRN1 antibody was raised using the C terminal of MKRN1 corresponding to a region with amino acids RYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFWVEGFR2 antibody
The VEGFR2 antibody is a highly specialized monoclonal antibody that targets vascular endothelial growth factor receptor 2 (VEGFR2). It is designed to specifically bind to this growth factor receptor and inhibit its activity. This antibody can be used in various life science research applications, including the study of angiogenesis, tumor growth, and cardiovascular development.KIAA0284 antibody
KIAA0284 antibody was raised using the N terminal of KIAA0284 corresponding to a region with amino acids QLTKARKQEEDDSLSDAGTYTIETEAQDTEVEEARKMIDQVFGVLESPEL
C10ORF96 antibody
C10ORF96 antibody was raised using the middle region of C10Orf96 corresponding to a region with amino acids QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENESMRP3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for its growth. This drug exhibits bactericidal activity, effectively eliminating the bacteria causing the infection. Its mechanism of action involves binding to DNA-dependent RNA polymerase, which hinders transcription and replication processes necessary for bacterial survival. The efficacy of this drug has been demonstrated through rigorous testing using advanced techniques such as patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations in the body, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, 6-Fluoro-3-indoxyl-beta-D-galactopyranosAKT antibody
Akt, also known as Protein Kinase B (PKB), is a key enzyme involved in regulating cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to signals like growth factors. Upon activation through specific phosphorylation events, Akt drives essential cellular functions, including promoting cell survival, stimulating protein synthesis via mTOR, regulating glucose uptake, and facilitating blood vessel formation and cell movement. Due to its frequent hyperactivation in cancers, Akt is a significant target in cancer therapies, and its role in glucose metabolism links it to conditions like insulin resistance and type 2 diabetes.Goat anti Mouse IgM (HRP)
Goat anti-mouse IgM (HRP) was raised in goat using murine IgM mu chain as the immunogen.Degré de pureté :By ImmunoelectrophoresisCHIC1 antibody
CHIC1 antibody was raised using the N terminal of CHIC1 corresponding to a region with amino acids LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRVCD153 antibody
The CD153 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets CD153, a protein expressed on pluripotent stem cells. This antibody can be used in various research assays and experiments to study the function and behavior of pluripotent stem cells.EXOSC10 antibody
EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGS100 antibody
The S100 antibody is a highly specialized protein that plays a crucial role in various biological processes. It acts as a phosphatase and interacts with other proteins such as erythropoietin, interleukin-6, actin, collagen, fibrinogen, and β-catenin. This antibody is widely used in the field of Life Sciences for research purposes.STAT3 antibody
STAT3 antibody was raised in Mouse using a purified recombinant fragment of STAT3 expressed in E. coli as the immunogen.Human IgG antibody
The Human IgG antibody is a powerful inhibitory factor that targets various proteins and factors in the body. It has been shown to inhibit the activity of GM-CSF (colony-stimulating factor) and other cytokines involved in immune response regulation. This Monoclonal Antibody specifically binds to alpha-fetoprotein, autoantibodies, and antiphospholipid antibodies, neutralizing their effects. Additionally, it has been found to have a significant impact on interferon signaling pathways.CDCA2 antibody
The CDCA2 antibody is a highly effective protein kinase inhibitor that belongs to the family of kinase inhibitors. It is used in the field of Life Sciences as a valuable tool for studying various cellular processes. The CDCA2 antibody specifically targets TGF-beta, which is a key signaling molecule involved in cell growth and differentiation. This antibody can be used in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. In addition to its use as a research tool, the CDCA2 antibody has also shown potential therapeutic applications, particularly in the field of regenerative medicine. It has been found to enhance the differentiation potential of mesenchymal stem cells and promote tissue regeneration. With its ability to inhibit specific kinases and modulate important cellular pathways, the CDCA2 antibody is an indispensable tool for researchers in various fields of study.Netrin 1 antibody
The Netrin 1 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Netrin 1, a protein involved in various cellular processes. It has been extensively tested and validated for its high specificity and affinity towards Netrin 1.MED31 antibody
MED31 antibody was raised using the N terminal of MED31 corresponding to a region with amino acids MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNRALY antibody
RALY antibody was raised using the middle region of RALY corresponding to a region with amino acids KIKLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGCP3 antibody
The GCP3 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and exhibits strong antigen-antibody reaction capabilities. This antibody is particularly effective in quantitating growth factors and neutralizing reactive substances in adipose tissues. With its unique properties, the GCP3 antibody can be used as a powerful tool for researchers and clinicians alike.Apelin antibody
The Apelin antibody is a multidrug that belongs to the class of Polyclonal Antibodies. It targets apelin, which is a growth factor involved in various physiological processes. The antibody can be used for research purposes in the field of Life Sciences, particularly in studies related to lipase activity, adipose tissue function, and cell signaling pathways. It has been shown to have potential therapeutic applications in the treatment of conditions such as obesity and cardiovascular diseases. The Apelin antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option based on their specific experimental needs. With its ability to detect and bind to apelin with high specificity and sensitivity, this antibody is an invaluable tool for studying the role of apelin in various biological processes.IKB α antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. Known for its bactericidal activity, this drug effectively treats tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through various scientific techniques such as patch-clamp technique on human erythrocytes. Metabolized through different metabolic transformations, including hydrolysis and oxidation, this drug specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.CD5 antibody (Spectral Red)
CD5 antibody (Spectral Red) was raised in rat using CD5/Lyt-1 as the immunogen.ApoBEC2 antibody
ApoBEC2 antibody was raised using the middle region of APOBEC2 corresponding to a region with amino acids CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILSF1 antibody
SF1 antibody was raised using the C terminal of SF1 corresponding to a region with amino acids APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWWHNF4 alpha antibody
The HNF4 alpha antibody is a highly effective reagent used in the field of Life Sciences. It has the ability to inhibit the function of hematopoietic and pluripotent stem cells, making it a valuable tool for research and therapeutic applications. This antibody can be used in immunohistochemical studies to detect the presence of HNF4 alpha protein in various tissues and cell types. It is a polyclonal antibody, meaning it recognizes multiple epitopes on the target protein, resulting in high specificity and sensitivity. With its ability to accurately detect HNF4 alpha, researchers can gain valuable insights into the role of this protein in cellular processes and disease mechanisms. Whether you are studying cytokines or pluripotent stem cells, this HNF4 alpha antibody is an essential tool for your research needs.GLS2 antibody
GLS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFHDAC5 antibody
The HDAC5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to HDAC5, which stands for Histone Deacetylase 5. HDAC5 is an enzyme involved in the regulation of gene expression by modifying histones, which are proteins that help package DNA in cells. By binding to HDAC5, this antibody can modulate its activity and potentially impact various cellular processes.SOX17 antibody
The SOX17 antibody is a monoclonal antibody that specifically targets glucagon, a hormone involved in regulating blood sugar levels. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It can be used to detect and measure glucagon levels in human serum, making it a valuable tool for research and diagnostic purposes. Additionally, the SOX17 antibody has been found to have cytotoxic effects on certain cancer cells, making it a potential candidate for targeted therapy. Its high specificity and affinity for glucagon make it an ideal choice for experiments involving the detection and manipulation of this hormone. Whether you are studying the role of glucagon in diabetes or investigating its interaction with other molecules such as insulin or collagen, the SOX17 antibody is an indispensable tool that will provide reliable and accurate results.TFEB antibody
The TFEB antibody is a highly specialized product in the field of Life Sciences. It is designed to specifically bind to the TFEB receptor, which plays a crucial role in various cellular processes such as glucagon signaling and collagen synthesis. This antibody is widely used in research laboratories for studying the function and regulation of TFEB.Helicobacter pylori antibody
The Helicobacter pylori antibody is a monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the helicobacter bacteria, allowing for the detection and study of this pathogen. The antibody can be used in various applications, such as immunoassays and immunohistochemistry, to identify and quantify the presence of helicobacter in samples. Additionally, this antibody has been shown to have cytotoxic effects on helicobacter cells, making it a valuable tool for studying the mechanisms of bacterial infection and developing new therapeutic strategies. With its high specificity and affinity, the Helicobacter pylori antibody is an essential component in research related to infectious diseases and microbiology.CD18 antibody
CD18 antibody was raised in mouse using leucocytes from LGL-type leukemia as the immunogen.NFkB p65 antibody
The NFkB p65 antibody is a polyclonal antibody that is used for various applications in the field of Life Sciences. It is specifically designed to target and neutralize the NFkB p65 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for techniques such as hybridization, immunoprecipitation, and immunofluorescence.ALOX15B antibody
ALOX15B antibody was raised using the C terminal of ALOX15B corresponding to a region with amino acids ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRC2ORF29 antibody
C2ORF29 antibody was raised using the middle region of C2Orf29 corresponding to a region with amino acids SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQIGPC5 antibody
The GPC5 antibody is a highly specialized Polyclonal Antibody that targets the lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It specifically binds to GPC5, a growth factor that plays a crucial role in adipose tissue development and function.Rabbit anti Mouse IgG3 (HRP)
Rabbit anti-mouse IgG3 (HRP) was raised in rabbit using murine IgG3 heavy chain as the immunogen.RNF121 antibody
RNF121 antibody was raised using the N terminal of RNF121 corresponding to a region with amino acids WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATGCARS antibody
CARS antibody was raised using the C terminal of CARS corresponding to a region with amino acids KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD
PBEF1 antibody
PBEF1 antibody was raised using the C terminal of PBEF1 corresponding to a region with amino acids VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH
