Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
SFRS8 antibody
SFRS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSEC16ORF46 antibody
C16ORF46 antibody was raised using the N terminal Of C16Orf46 corresponding to a region with amino acids LSHWSLQTKPPTEGGPEKDQSSPSQTQAAPQGPSTASRAISDICFPTYFRCCDC60 antibody
CCDC60 antibody was raised using the C terminal of CCDC60 corresponding to a region with amino acids RPAKKILVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFVKeratin 14 antibody
The Keratin 14 antibody is a highly specialized antibody that is used in various solid phase assays. It can be used for antibody-drug conjugation, making it a valuable tool in the field of Life Sciences. This antibody specifically targets and binds to keratin 14, a protein involved in the structure and function of epithelial cells.Donkey anti Human IgG (H + L) (FITC)
Donkey anti-human IgG (H + L) (FITC) was raised in donkey using human IgG (H&L) as the immunogen.EFHA2 antibody
EFHA2 antibody was raised using the N terminal of EFHA2 corresponding to a region with amino acids AAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIP
MRC2 antibody
The MRC2 antibody is a highly specific monoclonal antibody that targets the MRC2 protein. This protein is involved in various cellular processes, including insulin signaling, collagen metabolism, and cell adhesion. The MRC2 antibody has been extensively studied and has shown great potential in research and diagnostic applications.Matrin 3 antibody
Matrin 3 antibody was raised using the C terminal of MATR3 corresponding to a region with amino acids ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTGCHCHD3 antibody
CHCHD3 antibody was raised using the N terminal of CHCHD3 corresponding to a region with amino acids RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKRVARS antibody
VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKMLCHK1 antibody
The CHK1 antibody is a specific antibody that targets the checkpoint kinase 1 (CHK1) protein. It has been extensively used in life sciences research to study various cellular processes and signaling pathways. The CHK1 protein plays a crucial role in cell cycle regulation, DNA damage response, and cell survival. By inhibiting CHK1, this antibody can help researchers gain insights into the mechanisms of cancer development and identify potential therapeutic targets.
SUMO1 antibody
The SUMO1 antibody is a glycoprotein that belongs to the class of lectins. It is a monoclonal antibody that specifically targets SUMO1, a small ubiquitin-like modifier protein. This antibody has been extensively used in research and diagnostics in the field of Life Sciences. The SUMO1 antibody has high specificity and affinity for its target, making it an ideal tool for studying the function and regulation of SUMOylation. It can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. Additionally, this antibody has been shown to inhibit protease activity associated with SUMOylation, making it a valuable tool for investigating the role of SUMOylation in cellular processes. With its unique properties and wide range of applications, the SUMO1 antibody is an essential tool for researchers in the field of protein kinase inhibitors and autoantibodies.
ST3GAL5 antibody
ST3GAL5 antibody was raised using the N terminal of ST3GAL5 corresponding to a region with amino acids DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
C2orf30 antibody
C2orf30 antibody was raised using the middle region of C2orf30 corresponding to a region with amino acids GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTVCLIC1 antibody
CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTLCK antibody
The LCK antibody is a monoclonal antibody that targets LCK, a protein involved in T cell signaling. This antibody is commonly used in Life Sciences research to study immune responses and investigate the role of LCK in various cellular processes. It has been shown to be effective in blocking LCK activity, leading to decreased T cell activation and cytotoxicity. Additionally, the LCK antibody has potential therapeutic applications as it can be used to develop immunogenic compositions for the treatment of viral infections or autoimmune diseases. Its high specificity and affinity make it a valuable tool for scientists working in the field of immunology and drug discovery.Helicobacter pylori antibody
Helicobacter pylori antibody is a monoclonal antibody used in the field of Life Sciences. It is colloidal in nature and specifically targets Helicobacter, a bacterium known to cause various gastrointestinal disorders. This antibody has also been found to have anti-VEGF (vascular endothelial growth factor) properties, making it potentially useful in antiangiogenic therapies. Additionally, it has shown promising results in combination with sorafenib, a drug used in the treatment of certain types of cancer. The microsphere formulation of this antibody allows for targeted delivery and enhanced efficacy. Furthermore, studies have indicated its potential role in regulating erythropoietin levels and modulating brain natriuretic peptide and calmodulin signaling pathways. With its multifaceted properties, this monoclonal antibody holds great promise for advancements in the field of medical research and therapeutics.MRTO4 antibody
MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGTPBP9 antibody
GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHCDH2 antibody
The CDH2 antibody is a monoclonal antibody that targets the CDH2 protein expressed in various tissues, including rat liver microsomes. This antibody is widely used in Life Sciences research to study the role of CDH2 in different biological processes. It has been shown to have cholinergic and catecholaminergic properties, affecting neurotransmitter release and signaling pathways. Additionally, the CDH2 antibody has been found to modulate the expression of interleukin-6 and dopamine in rat liver microsomes. Its binding to the CDH2 protein leads to lysis of target cells and inhibition of cellular functions. Researchers also utilize this antibody to detect the presence of CDH2 in samples using techniques like immunofluorescence or Western blotting. The CDH2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs.Apolipoprotein E antibody
The Apolipoprotein E antibody is a polyclonal antibody that specifically targets the colony-stimulating factor (CSF) Apolipoprotein E. This antibody has been shown to have neutralizing effects on the toxic effects of CSF, making it a valuable tool for research in the field of immunology. It has also been shown to inhibit the activity of alpha-fetoprotein and family kinase inhibitor, further highlighting its versatility in various applications. The Apolipoprotein E antibody can be used in immunoassays such as ELISA or Western blotting to detect and quantify the presence of this protein in biological samples. With its high specificity and affinity, this monoclonal antibody is an essential tool for researchers studying the role of Apolipoprotein E in various physiological processes.PR6 antibody
The PR6 antibody is a highly specialized monoclonal antibody with unique characteristics. It has been extensively studied for its hybridization capabilities and its ability to bind to the amino-terminal region of specific proteins. This antibody exhibits high viscosity, making it ideal for use in assays that require increased sensitivity.Neuropilin 1 antibody
The Neuropilin 1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to the neuropilin 1 molecule, which plays a crucial role in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.CSTF2 antibody
CSTF2 antibody was raised using the N terminal of CSTF2 corresponding to a region with amino acids VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQAKLHL12 antibody
KLHL12 antibody was raised in Mouse using a purified recombinant fragment of human KLHL12 expressed in E. coli as the immunogen.TGF beta1 Antibody
The TGF beta1 Antibody is a highly specialized antibody that targets the transforming growth factor beta 1 (TGF-β1), a key protein involved in various biological processes. This antibody has been extensively researched and is widely used in Life Sciences for its ability to neutralize the effects of TGF-β1.Synapsin 1 antibody
The Synapsin 1 antibody is a highly specialized polyclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and bind to Synapsin 1, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. This antibody can be used for various applications such as immunohistochemistry, western blotting, and ELISA.FAM81A antibody
FAM81A antibody was raised using the N terminal of FAM81A corresponding to a region with amino acids GDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKTCyclin B1 antibody
The Cyclin B1 antibody is a highly specific monoclonal antibody that targets the virus surface antigen, influenza hemagglutinin. It is widely used in Life Sciences research to study the role of cyclin B1 in cell cycle regulation and cellular processes. This antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. The Cyclin B1 antibody has been shown to have high affinity and specificity for its target, making it an excellent tool for researchers studying cell division and proliferation. Additionally, this antibody has neutralizing activity against certain strains of influenza virus, making it a potential therapeutic candidate for antiviral treatments. With its exceptional performance and versatility, the Cyclin B1 antibody is a valuable asset in any laboratory setting.UBE2I antibody
UBE2I antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG
p63 antibody
The p63 antibody is a cytotoxic agent that belongs to the class of antibodies used in Life Sciences. It is activated upon binding to its target antigen and has been shown to be effective in various research applications. The p63 antibody can be used for immunohistochemistry studies to detect the presence and localization of specific proteins or markers in tissue samples. It can also be used as a tool for protein analysis, such as Western blotting or ELISA assays. The p63 antibody has been used in studies involving alpha-fetoprotein, sclerostin, and phosphatase, among others. It is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific experimental needs. With its high specificity and sensitivity, the p63 antibody is a valuable tool for researchers in the field of Life Sciences.CXCL10 antibody
The CXCL10 antibody is a highly specialized antibody that has a wide range of applications in the field of Life Sciences. It has been extensively studied for its inhibitory and neutralizing effects on insulin-like growth factor-I (IGF-I) and CXCL13, which are important factors in various biological processes. This antibody has been shown to have anti-angiogenic and anti-fibrotic effects, making it a potential therapeutic option for conditions such as cancer and fibrosis. Additionally, the CXCL10 antibody has been found to have a chemotactic effect on mesenchymal stem cells, further highlighting its versatility in different research areas. This antibody is available as a polyclonal antibody and can be used as a control antibody in various experimental settings.BAP31 antibody
The BAP31 antibody is a powerful tool in the field of Life Sciences. It is a multidrug antibody that targets retinoid and fibronectin, two important molecules involved in various cellular processes. This antibody has been extensively tested and proven to be highly effective in binding to these targets, making it an essential component in research and diagnostic applications.Hantavirus (Puumala) antibody
Hantavirus antibody was raised in mouse using recombinant puumala nucleocaspid protein as the immunogen.C1orf96 antibody
C1orf96 antibody was raised using the middle region of C1orf96 corresponding to a region with amino acids ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEKPSMA5 antibody
PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK
RAD51L3 antibody
RAD51L3 antibody was raised in rabbit using the C terminal of RAD51L3 as the immunogenResistin antibody (biotin)
Resistin antibody (biotin) was raised in goat using highly pure recombinant murine resistin as the immunogen.RBMS3 antibody
RBMS3 antibody was raised using the middle region of RBMS3 corresponding to a region with amino acids PTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKGM-CSF antibody
GM-CSF antibody was raised in rabbit using highly pure recombinant human GM-CSF as the immunogen.
