Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
SST antibody
The SST antibody is a monoclonal antibody that specifically targets amyloid plaques, which are protein clumps commonly associated with neurodegenerative diseases such as Alzheimer's. This antibody has been extensively used in Life Sciences research to study the formation and progression of these plaques. In addition to its use in research, the SST antibody can also be used in diagnostic applications for detecting the presence of amyloid plaques in patient samples. It has shown high specificity and sensitivity when tested against various forms of amyloid proteins. Furthermore, the SST antibody has demonstrated anti-angiogenesis properties, making it a potential therapeutic option for diseases characterized by abnormal blood vessel growth. With its ability to bind to low-molecular-weight compounds and activated surfaces, this antibody is a versatile tool for studying protein interactions and developing new treatments.GSTM5 antibody
GSTM5 antibody was raised using the N terminal of GSTM5 corresponding to a region with amino acids MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKNOC4L antibody
NOC4L antibody was raised using a synthetic peptide corresponding to a region with amino acids CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVSCaspase 3 antibody
The Caspase 3 antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is designed to target and detect the activity of caspase enzymes, which play a crucial role in programmed cell death (apoptosis). This antibody has been extensively validated for its specificity and sensitivity.alpha Synuclein antibody
The alpha Synuclein antibody is a powerful tool used in life sciences research. This monoclonal antibody specifically targets and binds to alpha Synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. By targeting this protein, the antibody allows researchers to study its role in the development and progression of these diseases.PDE1C antibody
PDE1C antibody was raised using the middle region of PDE1C corresponding to a region with amino acids IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRPSA antibody
PSA antibody was raised in Mouse using a purified recombinant fragment of KLK3 (aa26-251) expressed in E. coli as the immunogen.Androgen Receptor antibody
The Androgen Receptor antibody is a highly specialized product used in Life Sciences research. It is designed to target and detect the androgen receptor, a protein that plays a crucial role in the regulation of epidermal growth factor signaling pathways. This antibody is produced using state-of-the-art techniques, ensuring high specificity and sensitivity.UBA6 antibody
The UBA6 antibody is a polyclonal antibody that specifically targets alpha-synuclein, a protein kinase involved in various cellular processes. This antibody is cytotoxic and can be used in research studies to study the role of alpha-synuclein in different diseases. The UBA6 antibody has been shown to be activated by human serum and can bind to albumin, glucose transporter, mitogen-activated protein, nuclear, inhibitors, collagen, and other molecules. It is available as a monoclonal antibody and can be used for various applications in immunology and molecular biology research.
FOXO4 antibody
The FOXO4 antibody is a highly specialized protein that plays a crucial role in various biological processes. It specifically binds to FOXO4, a transcription factor involved in regulating gene expression. This antibody has been extensively studied and proven to be effective in immunoassays, making it an essential tool for researchers in the field of life sciences.TLR4 antibody
The TLR4 antibody is a highly effective product in the field of Life Sciences. It is specifically designed to neutralize tumor necrosis factor-alpha (TNF-α) and has been extensively tested in human serum. This antibody also has the ability to inhibit the activity of transforming growth factor-beta (TGF-beta), alpha-fetoprotein, phalloidin, and creatine kinase. With its neutralizing properties, it effectively targets collagen and glycoprotein, making it an ideal choice for researchers working with actin filaments and electrodes. The TLR4 antibody is a polyclonal antibody that guarantees accurate and reliable results for your experiments.CD105 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using the patch-clamp technique on human erythrocytes, confirming its high efficacy. Its active form undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.STK3 antibody
The STK3 antibody is a polyclonal antibody that targets the protein kinase STK3. This antibody is commonly used in Life Sciences research to study the role of STK3 in various cellular processes. STK3, also known as 3-kinase, is involved in the regulation of cell growth, proliferation, and apoptosis. It forms a protein complex with other molecules and acts as a critical signaling mediator. The STK3 antibody specifically recognizes and binds to STK3, allowing researchers to detect its presence and measure its activity levels. This antibody is highly specific and sensitive, making it an essential tool for studying the function of STK3 in different experimental systems. Whether you are investigating the role of STK3 in cancer development or exploring its involvement in signal transduction pathways, the STK3 antibody will provide valuable insights into your research.
HNRPL antibody
HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVPLOD2 antibody
The PLOD2 antibody is a highly advanced and specialized product in the field of Life Sciences. It belongs to the category of antibodies and is known for its high-flux inhibitory properties. This antibody is widely used as a serum marker and has been extensively studied as an interferon-stimulated gene. The PLOD2 antibody is designed to specifically target and bind to PLOD2, which is an important enzyme involved in collagen synthesis.CTNNB1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known to be highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.SOX9 antibody
The SOX9 antibody is a highly specialized antibody that targets extracellular histones and growth factor binding proteins. It has been shown to have antiviral properties and can effectively inhibit the growth of HL-60 cells. This antibody is a glycoprotein that can also be used as an autoantibody for diagnostic purposes. The SOX9 antibody is part of a collection of polyclonal antibodies that are widely used in life sciences research. In addition to its antiviral properties, this antibody has also shown promise as an anticancer agent due to its ability to modulate chemokine signaling pathways. Its multidrug reactive nature makes it a valuable tool in various research applications within the field of Life Sciences.
cMaf antibody
The cMaf antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that targets the protein cMaf, which plays a crucial role in various biological processes. This antibody is widely used in research and diagnostic applications.PDGFR alpha antibody
The PDGFR alpha antibody is a highly effective inhibitor that belongs to the class of polypeptides and monoclonal antibodies. It specifically targets the extracellular region of the PDGFR alpha protein, inhibiting its activity. This antibody has been extensively studied in Life Sciences and has shown remarkable efficacy in inhibiting the growth and proliferation of cells expressing PDGFR alpha. It binds to specific epitopes on the protein, preventing its interaction with ligands and downstream signaling pathways. The synthetic nature of this antibody ensures high specificity and potency, making it an ideal choice for research and therapeutic applications. Whether you are studying cellular processes or developing novel treatments, this PDGFR alpha antibody will provide reliable results and contribute to advancements in the field. Choose this antibody for its exceptional inhibiting properties and join the scientific community in unraveling the mysteries of cellular biology.BAD antibody
BAD antibody is a polyclonal antibody that targets the BAD protein, which plays a crucial role in regulating apoptosis (cell death) in adipose tissue. This antibody can be used as an inhibitor to study the function of BAD in adipocytes and other cell types. Additionally, it can be used as a research tool in the field of life sciences to investigate the mechanisms underlying cell death and survival. The BAD antibody is available as both polyclonal and monoclonal antibodies, offering researchers different options based on their specific needs. It has been shown to have neutralizing effects on the activity of BAD, making it a valuable tool for studying its function in various cellular processes.IKB alpha antibody
The IKB alpha antibody is a growth factor monoclonal antibody that specifically targets and binds to the IKB alpha protein. This protein plays a crucial role in regulating the activity of NF-kappaB, a transcription factor involved in various cellular processes such as inflammation, immune response, and cell survival. By binding to IKB alpha, this antibody prevents its degradation and inhibits the activation of NF-kappaB.
SNUPN antibody
SNUPN antibody was raised using the middle region of SNUPN corresponding to a region with amino acids GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYELα 1 Antichymotrypsin antibody
Alpha-1 antichymotrypsin antibody was raised in mouse using affinity purified alpha-1 antichymotrypsin as the immunogen.ATF2 antibody
The ATF2 antibody is a highly specialized antibody that has a wide range of applications in the field of Life Sciences. It is specifically designed to target and bind to ATF2, a protein that plays a crucial role in various cellular processes. This antibody is commonly used in research studies to investigate the function and regulation of ATF2.BCR antibody
The BCR antibody is a polyclonal antibody that targets the B-cell receptor (BCR), a protein involved in the regulation of immune responses. It specifically recognizes and binds to the epitopes present on the BCR, allowing for the detection and analysis of B-cell activity. This antibody has been widely used in various life sciences research applications, including immunohistochemistry, flow cytometry, and western blotting. Additionally, it has shown potential therapeutic applications in the treatment of autoimmune diseases and certain types of cancer. With its high specificity and sensitivity, the BCR antibody is an essential tool for researchers studying B-cell biology and related fields.BIP antibody
The BIP antibody is a monoclonal antibody that specifically targets and neutralizes the activity of BIP (Binding Immunoglobulin Protein). This protein plays a crucial role in various cellular processes, including protein folding and quality control. The BIP antibody is derived from globulin and is produced using advanced biotechnological methods.RNPC3 antibody
RNPC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELAJAK3 antibody
The JAK3 antibody is a monoclonal antibody that specifically targets the activated form of the JAK3 protein. This antibody is commonly used in research and diagnostic applications to detect and quantify the presence of JAK3 in human serum samples. The JAK3 antibody can be immobilized on an electrode or colloidal surface to create a sensitive and specific assay for detecting JAK3 levels. It is also used in studies investigating growth factors, autoantibodies, and collagen-related diseases. The high specificity and affinity of this monoclonal antibody make it an essential tool for researchers studying helicobacter infections and other diseases involving the JAK3 pathway. Additionally, the JAK3 antibody can be used in combination with other antibodies, such as polyclonal antibodies, to enhance detection sensitivity and accuracy.
GPR180 antibody
The GPR180 antibody is a highly specialized monoclonal antibody that targets the G protein-coupled receptor 180 (GPR180). This antibody has been developed for use in Life Sciences research and is widely used in various assays and experiments. The GPR180 antibody specifically binds to the GPR180 antigen, neutralizing its activity and preventing downstream signaling events.CD138 antibody
CD138 antibody is a monoclonal antibody used in the field of Life Sciences. It is known for its antiviral properties and its ability to target specific molecules in the body. This antibody specifically binds to CD138, a glycoprotein that is expressed on the surface of activated plasma cells. By binding to CD138, this antibody can inhibit the activity of phosphatases and chemokines, which play important roles in immune responses. Additionally, CD138 antibody has neutralizing effects on certain viruses and can be used in immunoassays to detect the presence of specific antigens in human serum. With its high specificity and effectiveness, CD138 antibody is a valuable tool in research and diagnostic applications within the field of Life Sciences.BLNK antibody
The BLNK antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and inhibit the activity of glucokinase, a key enzyme involved in glucose metabolism. This antibody shows great potential as a therapeutic agent for various conditions, including diabetes and metabolic disorders.
FRK antibody
The FRK antibody is a protein that has various functions in the body. It acts as an anticoagulant, meaning it helps prevent blood clotting. Additionally, it plays a role in regulating glucagon and erythropoietin levels, which are important hormones involved in metabolism and red blood cell production, respectively.CK19 antibody
The CK19 antibody is a highly specialized monoclonal antibody used in the field of life sciences. It is designed to target and bind to the protein known as cytokeratin 19 (CK19). This glycopeptide is found in various tissues, including epithelial cells and certain types of cancer cells.
Cytokeratin 19 antibody
Cytokeratin 19 antibody is a highly specific monoclonal antibody that targets protein isoforms of cytokeratin 19, a glycoprotein expressed in various tissues. This antibody acts as an inhibitor, blocking the activity of cytokeratin 19 and preventing its interaction with other proteins. It can be used in research and diagnostic applications to study the role of cytokeratin 19 in different cellular processes.Connexin 26 antibody
Connexin 26 antibody is a highly specialized family kinase inhibitor that belongs to the class of polyclonal antibodies. It targets the epidermal growth factor and other growth factors, inhibiting their activity and preventing cell proliferation. This antibody can also be used in Life Sciences research to study the activation of various signaling pathways, including those involving interferon and β-catenin. Additionally, it has been shown to inhibit phosphatase activity and block the expression of virus surface antigens. Connexin 26 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with a variety of options for their experiments. Its cytotoxic properties make it a valuable tool for studying protein interactions and developing targeted inhibitors.
Troponin I antibody
Troponin I antibody is a polyclonal antibody that specifically targets troponin I, a protein found in cardiac muscle. This antibody has a high affinity for troponin I and can be used in various applications such as immunoassays, western blotting, and immunohistochemistry. It has been shown to have low background binding and excellent sensitivity, making it an ideal tool for detecting and quantifying troponin I levels in biological samples. The neutralizing properties of this antibody allow for the inhibition of troponin I function, providing valuable insights into its role in cardiac muscle contraction. Additionally, this antibody can be used for endocytic uptake studies to investigate the internalization of troponin I and its potential involvement in cellular processes. With its nanocomposite colloidal formulation, this antibody offers enhanced stability and ease of use. Whether you are conducting research in the field of life sciences or developing diagnostic assays, the troponin I antibody is an essential tool for studyingLGALS3BP antibody
The LGALS3BP antibody is a highly specific monoclonal antibody that targets the LGALS3BP protein. This protein plays a crucial role in various biological processes, including cell adhesion, migration, and immune response. The LGALS3BP antibody has been engineered to have high affinity and specificity for the LGALS3BP protein, making it an ideal tool for research in Life Sciences.PDE10A antibody
The PDE10A antibody is a highly specialized inhibitor used in Life Sciences research. It targets the mitogen-activated protein kinase kinase (MAPKK) pathway, which plays a crucial role in cell growth and differentiation. This antibody has been extensively tested and proven effective in blocking the activity of PDE10A, a protein kinase that regulates various cellular processes.BRAF antibody
The BRAF antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to the BRAF protein, which plays a crucial role in cell growth and division. By binding to this protein, the antibody inhibits its catalase activity, preventing abnormal cell proliferation.
CrkII antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infections. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, it has been shown to specifically bind to markers expressed in Mycobacterium tuberculosis strains, leading to inhibition of cell growth. The metabolization process involves various transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.Aggrecan antibody
The Aggrecan antibody is a monoclonal antibody that specifically targets the aggrecan molecule. Aggrecan is a large proteoglycan found in the extracellular matrix of various tissues, including cartilage and intervertebral discs. This antibody has been shown to have cytotoxic effects on cells that express high levels of aggrecan, making it a potential therapeutic option for conditions involving excessive aggrecan production or accumulation.SFTPB antibody
The SFTPB antibody is a specific antibody used in Life Sciences research. It is a monoclonal antibody that specifically binds to surfactant protein B (SFTPB), which plays a crucial role in lung function. This antibody can be used for various applications, including the detection and quantification of SFTPB in samples such as human serum or tissue lysates. Additionally, it has been shown to have serum albumin-binding properties, making it useful for studies involving serum albumin or related proteins. The SFTPB antibody can also be used in combination with other antibodies, such as anti-thyroglobulin antibodies or phospholipid scramblase antibodies, to investigate specific pathways or protein interactions. Its high affinity and specificity make it an essential tool for researchers studying lung biology or related fields.
ERK8 antibody
The ERK8 antibody is a polyclonal antibody that specifically targets the protein kinase ERK8. It is commonly used in life sciences research to study the expression and function of this important signaling molecule. The antibody can be used for various applications, including immunofluorescence, immunohistochemistry, and Western blotting. It has been shown to effectively detect ERK8 in microvessel endothelial cells and other cell types. The ERK8 antibody is a valuable tool for researchers studying signal transduction pathways, cell proliferation, and differentiation. Its high specificity and sensitivity make it an essential component of any laboratory studying protein kinases and their role in cellular processes.
