Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
CSTF2T antibody
CSTF2T antibody was raised using the C terminal of CSTF2T corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVTSYT1 antibody
The SYT1 antibody is a monoclonal antibody that specifically targets the Synaptotagmin-1 (SYT1) antigen. It is widely used in Life Sciences research for various applications, including the detection and analysis of SYT1 expression in cells and tissues. This antibody has been shown to have high specificity and sensitivity, making it a valuable tool for studying the role of SYT1 in synaptic transmission, neurotransmitter release, and other cellular processes.
SNAP23 antibody
The SNAP23 antibody is a highly specialized polyclonal antibody that targets the necrosis factor-related apoptosis-inducing protein complex. It is commonly used in the field of Life Sciences to study endothelial growth and other related processes. This antibody can also be used as a monoclonal antibody to neutralize specific proteins or growth factors in human serum. Additionally, it has been shown to have a high affinity for steroid receptors and can be used in various nuclear studies. With its advanced technology and specificity, the SNAP23 antibody is an essential tool for researchers in the field of Life Sciences.RPA2 antibody
The RPA2 antibody is a biomolecule that belongs to the category of antibodies. It is cytotoxic and is widely used in the field of Life Sciences for various applications. This monoclonal antibody can be used as an electrode for detecting specific binding proteins in biological samples, such as human serum. The RPA2 antibody has been shown to have high affinity and specificity towards its target molecules, making it a valuable tool in research and diagnostics. Additionally, this antibody has been found to interact with various biomolecules, including glutamate, chemokines, antiangiogenic factors, collagen, endothelial growth factors, and fatty acids. Its versatility and effectiveness make it a valuable asset in scientific studies and experiments.Mt6 antibody
The Mt6 antibody is a monoclonal antibody that specifically targets the 5-ht7 receptor. It is derived from human serum and has been extensively studied in the field of Life Sciences. The Mt6 antibody has shown high affinity for the 5-ht7 receptor, binding to specific acid residues on the receptor surface. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.
KLK13 antibody
KLK13 antibody was raised using the middle region of KLK13 corresponding to a region with amino acids VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNhCG antibody
The hCG antibody is a monoclonal antibody that acts as an inhibitor of endothelial growth and has antiangiogenic properties. It can be used in various applications, including research in the field of Life Sciences. This antibody has been shown to effectively target and bind to specific proteins, such as protein kinase and cytotoxic antibodies, which are involved in cell growth and proliferation. The hCG antibody can also specifically recognize and bind to receptors, such as the erythropoietin receptor and c-myc, leading to activation or inhibition of specific pathways. Its high specificity makes it a valuable tool for studying the role of growth factors and their signaling pathways in various biological processes. With its advanced hybridization technology, this antibody offers precise targeting capabilities for researchers in need of accurate results.ACIN1 antibody
ACIN1 antibody was raised in mouse using recombinant Human Apoptotic Chromatin Condensation Inducer 1 (Acin1)HSPBP1 antibody
The HSPBP1 antibody is a monoclonal antibody used in the field of Life Sciences. It is a biomolecule that specifically targets and binds to HSPBP1, a growth factor involved in various cellular processes. This antibody has been shown to have high affinity for HSPBP1 and can be used for various research applications.
GADD34 antibody
The GADD34 antibody is a highly specialized antibody that targets and neutralizes the activity of tumor necrosis factor-alpha (TNF-α), a potent growth factor involved in various inflammatory processes. This antibody, also known as adalimumab, has been extensively studied and proven to effectively bind to TNF-α, preventing its activation and subsequent inflammatory response.AKAP7 antibody
AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DERLAKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKEpha10 antibody
The Epha10 antibody is a monoclonal antibody that specifically targets the EPHA10 protein. This protein plays a crucial role in various biological processes, including cell growth and development. The antibody is produced using histidine-isothiocyanate inhibitors, ensuring high specificity and efficacy.LOC642486 antibody
LOC642486 antibody was raised using the C terminal of LOC642486 corresponding to a region with amino acids AQASDLAENAPASPDVVISCHYCHRPPYTNSTRPAPPRLQPPLPGVQLQPSYNJ2 antibody
The SYNJ2 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets neuronspecific enolase and can be used to study adipose tissue and neuronal activity. This antibody has been shown to inhibit the activity of COX-2, an enzyme involved in inflammation, making it a potential therapeutic option for inflammatory conditions. Additionally, the SYNJ2 antibody has been used in particle reaction assays and transcription-polymerase chain reaction experiments to detect and measure the expression of specific proteins, such as β-catenin. Whether you're conducting research or developing a new medicament, this specific antibody can provide valuable insights into cellular processes and protein interactions.
NMT1 antibody
NMT1 antibody was raised using the N terminal of NMT1 corresponding to a region with amino acids TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTToll-like receptor 4 antibody
Toll-like receptor 4 antibody is an agonist protein that binds to Toll-like receptor 4, a cell surface receptor involved in the immune response. This antibody acts as a growth factor by promoting the activation of immune cells and enhancing their cytotoxic activity. It can also bind to other proteins such as anti-VEGF (vascular endothelial growth factor), insulin antibody, erythropoietin, c-myc, and insulin. Toll-like receptor 4 antibody has been shown to have nuclear localization and is widely used in life sciences research for studying immune responses and inflammation. Its cytotoxic properties make it a valuable tool for investigating cellular signaling pathways and developing therapeutic interventions.ID1 antibody
ID1 antibody was raised in mouse using recombinant Human Inhibitor Of Dna Binding 1, Dominant Negative Helixloop-Helix Protein (Id1)IL2 antibody
The IL2 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to IL2, a cytokine involved in immune responses. This antibody has been extensively studied and proven to have numerous applications.COL3A1 antibody
The COL3A1 antibody is a highly specialized immunoassay tool used for the detection and analysis of autoantibodies in human serum samples. This monoclonal antibody specifically targets COL3A1, a protein involved in the synthesis of collagen type III. The COL3A1 antibody can be used in various applications, including lysis assays and electrode-based immunoassays, to study the expression and function of this protein.CD115 antibody
The CD115 antibody is a monoclonal antibody that specifically binds to the CD115 receptor, also known as colony-stimulating factor 1 receptor (CSF1R). This receptor is involved in various cellular processes, including cell proliferation, differentiation, and survival. By binding to CD115, the antibody blocks the interaction between CSF1R and its ligand, thereby inhibiting downstream signaling pathways.CDC6 antibody
The CDC6 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets CDC6, a protein involved in DNA replication and cell cycle regulation. This antibody has been extensively tested and validated for use in various applications, including immunohistochemistry, western blotting, and flow cytometry.PRL antibody
The PRL antibody is a monoclonal antibody known as trastuzumab. It is used in the treatment of certain types of cancer, particularly breast cancer that overexpresses the HER2 protein. This antibody works by binding to the HER2 receptors on cancer cells, inhibiting their growth and promoting cell death. In addition to its anti-cancer properties, trastuzumab has been shown to have other therapeutic effects. It can enhance the activity of lysozyme, an enzyme involved in immune defense, and stimulate tyrosine kinase receptors, which play a role in cell growth and development. Furthermore, trastuzumab has been found to inhibit insulin-like growth factor signaling and dopamine release, both of which are implicated in tumor progression. Overall, this monoclonal antibody offers targeted therapy for HER2-positive cancers and holds promise for improving patient outcomes.Aquaporin 5 antibody
Aquaporin 5 antibody is a polyclonal antibody that specifically targets the Aquaporin 5 protein. Aquaporins are a family of integral membrane proteins that facilitate the transport of water across cell membranes. Aquaporin 5 is primarily found in the salivary glands, lungs, and lacrimal glands, where it plays a crucial role in regulating fluid secretion.
Adrenomedullin antibody
The Adrenomedullin antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the activity of Adrenomedullin, a glycopeptide hormone involved in various physiological processes. This antibody specifically binds to Adrenomedullin dimers and prevents their interaction with receptors, thereby blocking the downstream signaling pathways.TMLHE antibody
TMLHE antibody was raised using the middle region of TMLHE corresponding to a region with amino acids PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWVBACH1 antibody
The BACH1 antibody is a polyclonal antibody commonly used in Life Sciences research. It is specifically designed to target and bind to the activated form of BACH1, a human protein involved in various cellular processes. This antibody is highly reactive and can be used in immunoassays to detect and quantify BACH1 levels in biological samples.KRT8 antibody
The KRT8 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is designed to specifically target and bind to keratin 8, a protein found in various tissues. This antibody can be used for research purposes, such as detecting and quantifying levels of keratin 8 in samples. The KRT8 antibody is conjugated with magnetic particles, allowing for easy separation and purification of the target protein. With its high specificity and affinity, this monoclonal antibody ensures accurate and reliable results in various applications within the life sciences field. Additionally, it has been shown to have erbb2 inhibitory properties and interacts with spleen ferritin, a metal-binding protein. Its multispecific nature allows for versatility in experimental designs.IFN gamma antibody
IFN Gamma antibody was raised in mouse using recombinant interferon gamma as the immunogen.ODC1 antibody
The ODC1 antibody is a cytotoxic conjugate that targets the growth factor ODC1. It is a monoclonal antibody that specifically binds to ODC1, inhibiting its activity and preventing cell growth. This antibody has been extensively studied and shown to have potent cytotoxic effects on cancer cells. It is also glycosylated, which enhances its stability and binding affinity. The ODC1 antibody has been used in various research applications, including the development of targeted therapies for cancer treatment. Additionally, it has been investigated as a potential diagnostic tool for detecting autoantibodies against ODC1 in human serum. This antibody shows promise in combination with other therapeutic agents, such as anti-CD20 antibodies or anti-CD33 antibodies, as well as inhibitors of epidermal growth factor (EGF) signaling pathways. Its unique mechanism of action makes it a valuable tool for researchers and clinicians working in the field of oncology.BAX antibody
The BAX antibody is a highly specialized monoclonal antibody that targets the BAX protein, which plays a crucial role in programmed cell death (apoptosis). This steroid and multidrug-resistant protein is involved in regulating the release of cytochrome c from mitochondria, ultimately leading to apoptosis. The BAX antibody specifically binds to the BAX protein, preventing its function and promoting cell survival.SATB1 antibody
The SATB1 antibody is a highly specialized monoclonal antibody that has been developed for targeted therapy in various medical applications. This antibody specifically targets and binds to SATB1, a protein that plays a crucial role in gene regulation and cellular function. By binding to SATB1, this antibody can modulate its activity and inhibit the growth of certain cells.TDGF1 antibody
The TDGF1 antibody is a monoclonal antibody that targets E-cadherin, a basic protein involved in cell adhesion. It acts as a neutralizing agent against epidermal growth factor (EGF), a potent growth factor that plays a crucial role in cell proliferation and differentiation. The TDGF1 antibody is widely used in the field of life sciences for various applications, including immunohistochemistry and Western blotting.ALAS2 antibody
ALAS2 antibody was raised using the C terminal of ALAS2 corresponding to a region with amino acids PTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACNBFSP1 antibody
BFSP1 antibody was raised using the N terminal of BFSP1 corresponding to a region with amino acids QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEMSRF antibody
The SRF antibody is a polyclonal antibody that targets the Serum Response Factor (SRF). SRF is a transcription factor that plays a crucial role in regulating gene expression, particularly in response to various stimuli such as interleukin-6, cholinergic signaling, and interferon. This antibody is widely used in life sciences research to study the function and regulation of SRF.MVK antibody
MVK antibody was raised using the N terminal of MVK corresponding to a region with amino acids LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAAPPP1CA antibody
PPP1CA antibody was raised using the N terminal of PPP1CA corresponding to a region with amino acids MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLCPIM1 antibody
PIM1 antibody was raised using the N terminal of PIM1 corresponding to a region with amino acids MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
PCNA antibody
The PCNA antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets proliferating cell nuclear antigen (PCNA), which plays a crucial role in DNA replication and repair. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and flow cytometry.
Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.GABARAP antibody
GABARAP antibody was raised using a synthetic peptide corresponding to a region with amino acids KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV
CDKN2AIP antibody
CDKN2AIP antibody was raised using the N terminal of CDKN2AIP corresponding to a region with amino acids RRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMAWANTrx antibody
The Trx antibody is a highly specific monoclonal antibody that targets a particular molecule. It is known for its neutralizing properties and its ability to bind to the target molecule with high affinity. The Trx antibody is commonly used in Life Sciences research, particularly in the field of Monoclonal Antibodies.RFXAP antibody
RFXAP antibody was raised in mouse using recombinant Regulatory Factor X-Associated Protein (Rfxap)
IRS1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.Actin antibody
The Actin antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets actin filaments, which are essential for cell structure and movement. It can be used in a variety of applications, including immunofluorescence, immunohistochemistry, and Western blotting.Fumarase antibody
Fumarase antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets fumarase, an enzyme involved in the Krebs cycle, and plays a crucial role in cellular energy production. This antibody has been extensively used to study various biological processes, including collagen synthesis, alpha-fetoprotein expression, and urokinase plasminogen activator activity. Additionally, it has proven valuable in investigating the role of fumarase in cell signaling pathways and growth factor regulation. The fumarase antibody is widely recognized for its high affinity and specificity, making it an essential tool for researchers working in diverse fields such as cell biology, immunology, and cancer research. With its ability to detect fumarase at a molecular level, this monoclonal antibody opens up new avenues for understanding complex biological mechanisms and developing novel therapeutic strategies.KRT8 antibody
The KRT8 antibody is a monoclonal antibody used in life sciences research. It specifically targets and binds to keratin 8 (KRT8), a protein found in epithelial cells. This antibody has been widely used in various bioassays and studies to detect the presence of KRT8 in different tissues and cell types. Additionally, it has shown potential therapeutic applications, such as in the development of targeted therapies for certain types of cancer.
