Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75562 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
RCC2 antibody
RCC2 antibody was raised using the middle region of RCC2 corresponding to a region with amino acids RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTGNB1 antibody
GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADC4ORF22 antibody
C4ORF22 antibody was raised using the N terminal Of C4Orf22 corresponding to a region with amino acids YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT
Osteopontin antibody
The Osteopontin antibody is a glycoprotein that has cytotoxic effects and interferes with the function of serine protease inhibitors. It is a type of monoclonal antibody that specifically targets osteopontin, a protein involved in various biological processes. This antibody has been shown to neutralize the activity of osteopontin, inhibiting its function and potentially preventing its involvement in disease progression. The Osteopontin antibody is commonly used in life sciences research and has shown promising results in studies related to cancer, inflammation, and other pathological conditions. With its ability to target specific molecules, this antibody offers great potential for therapeutic applications in the future.Giardia lamblia antibody
Giardia lamblia antibody is a monoclonal antibody that specifically targets and activates the immune response against Giardia lamblia, a parasite that causes gastrointestinal infections. This antibody binds to specific proteins expressed by the parasite, such as alpha-fetoprotein and β-catenin, preventing their function and inhibiting the growth and survival of Giardia lamblia. The use of this antibody in Life Sciences research has provided valuable insights into the mechanisms of host-parasite interactions and has led to the development of potential antiviral therapies. The formulation of this antibody includes excipients and polymers that enhance stability and prolong its shelf life. It can be used in various laboratory techniques, including immunoassays, immunofluorescence, and Western blotting, for the detection and quantification of Giardia lamblia in clinical samples.Forssman antigen antibody
The Forssman antigen antibody is a powerful biomolecule used in Life Sciences research. It exhibits protease activity and plays a crucial role in various biological processes. This monoclonal antibody targets the Forssman antigen, a glycoconjugate that is activated in response to certain stimuli. The Forssman antigen antibody has been extensively studied for its ability to neutralize the effects of the Forssman antigen and inhibit its binding to other proteins and cells. It has also shown potential as a therapeutic agent for autoimmune disorders, as it can interfere with the production of autoantibodies. Additionally, this antibody has been found to modulate the activity of growth factors and interferons, further highlighting its versatility in molecular biology research. With high bioavailability and specificity, the Forssman antigen antibody is an essential tool for scientists studying protein isoforms and exploring new avenues in immunology and biotechnology.Gamma synuclein antibody
The Gamma synuclein antibody is a monoclonal antibody used in Life Sciences research. It specifically targets gamma synuclein, a protein that plays a role in cellular processes related to reactive oxygen species and apoptosis. The antibody can be used for various applications, including immunohistochemistry and western blotting, to detect the presence of gamma synuclein in tissues and cells. Additionally, this antibody has been shown to have neuroprotective properties and may be useful in studying the effects of cytotoxic drugs on neuronal cells. Its high specificity and sensitivity make it an excellent tool for researchers studying the function and regulation of gamma synuclein.EpCAM antibody
EpCAM antibody was raised in mouse using HT-29 colon carcinoma cell line as the immunogen.ERK1 antibody
ERK1 antibody was raised in mouse using recombinant full length ERK1 protein as the immunogen.eNOS antibody
The eNOS antibody is a glycoprotein that is widely used in Life Sciences research. It is an essential tool for studying the expression and activity of endothelial nitric oxide synthase (eNOS), an enzyme involved in the production of nitric oxide. This monoclonal antibody specifically recognizes eNOS and can be used in various applications, including Western blotting, immunohistochemistry, and immunoassays.Allophycocyanin antibody
The Allophycocyanin antibody is a valuable tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to allophycocyanin, a fluorescent protein commonly used as a marker in biological research. This antibody is highly specific and sensitive, allowing for accurate detection and quantification of allophycocyanin in various samples.BDNF antibody
BDNF antibody is a type of monoclonal antibody that has neutralizing properties. It is commonly used in the field of life sciences for research purposes. BDNF (brain-derived neurotrophic factor) is a growth factor that plays a crucial role in the development and maintenance of neurons. The BDNF antibody binds to BDNF, preventing its activity and thereby providing a means to study its function.FSCN1 antibody
The FSCN1 antibody is a highly specialized monoclonal antibody that has been developed for various applications in biomedical research. This antibody specifically targets the human serum and can be used in a variety of assays, including electrode-based or chromatographic techniques.WDR13 antibody
The WDR13 antibody is a human antibody that targets estrogen receptors. It acts as a soluble inhibitor of estrogen, preventing its binding to the receptors and inhibiting its activity. In addition to its role in regulating estrogen signaling, the WDR13 antibody also inhibits the function of costimulatory molecules and other substances involved in various life sciences processes. This antibody has been shown to have an inhibitory effect on serum insulin levels and may be used in research or therapeutic applications related to hormone regulation. Furthermore, the WDR13 antibody can be utilized as an inhibitor of kinases or cell cycle inhibitors, making it a versatile tool for studying cellular processes and developing targeted therapies.ADORA2A antibody
The ADORA2A antibody is a highly specialized antibody used in the field of Life Sciences. It is derived from adeno-associated virus and is specifically designed to target and bind to the ADORA2A receptor. This receptor plays a crucial role in various biological processes, including nuclear signaling and interleukin production.
GLUR2 antibody
The GLUR2 antibody is a polyclonal antibody used in Life Sciences research. It is an inhibitor that targets the hydroxyl group of GLUR2, a receptor for glutamate. This antibody has been shown to have an inhibitory effect on the activity of GLUR2, making it a potential inhibitor for pharmaceutical preparations. The GLUR2 antibody binds to the hydroxyl group and prevents it from interacting with other molecules, such as hsp90 or rapamycin complex. By inhibiting the activity of GLUR2, this antibody may have therapeutic implications in various diseases and conditions related to glutamate signaling pathways.Insulin Receptor antibody
The Insulin Receptor antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the insulin receptor, a crucial protein involved in adipose tissue function, growth factor signaling, and cellular metabolism. This antibody has been extensively validated for its high specificity and neutralizing activity against the insulin receptor.PLEKHA4 antibody
PLEKHA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHSGLQMRRARSPDLFTPLSRPPSPLSLPRPRSAPARRPPAPSGDTAPPAARIH1 antibody
ARIH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRVLLQHVHEGYEKD
AGBL5 antibody
AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids RGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLSRARSFSTGTSAGG
C10ORF33 antibody
C10ORF33 antibody was raised using the N terminal Of C10Orf33 corresponding to a region with amino acids MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVIGAGHNGLVAADDAH1 antibody
DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTDegré de pureté :Min. 95%FXYD5 antibody
FXYD5 antibody was raised using the N terminal of FXYD5 corresponding to a region with amino acids LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDEXOC5 antibody
EXOC5 antibody was raised using the N terminal of EXOC5 corresponding to a region with amino acids ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI
BSG antibody
The BSG antibody is a highly specialized product in the field of Life Sciences. It is an antiviral monoclonal antibody that specifically targets and neutralizes the activated glycoprotein known as BSG (Basigin). This monoclonal antibody has been extensively studied and proven to have high affinity and specificity for BSG.HSV1 gG antibody
HSV1 gG antibody was raised in mouse using herpes simplex type 1 gG as the immunogen.AIM2 antibody
AIM2 antibody is a cytotoxic monoclonal antibody that targets the AIM2 protein. The AIM2 protein is involved in the regulation of cell growth and proliferation, specifically in the interaction between hyaluronic acid and epidermal growth factor receptors. This antibody can be used in various life science applications, including research, diagnostics, and therapeutic development.CD29 antibody
CD29 antibody was raised in mouse using recombinant human CD29 (34-141aa) purified from E. coli as the immunogen.CYTB antibody
CYTB antibody was raised using the N terminal of CYTB corresponding to a region with amino acids TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL
Degré de pureté :Min. 95%TMEM16C antibody
TMEM16C antibody was raised using the middle region of TMEM16C corresponding to a region with amino acids WWSRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIFDegré de pureté :Min. 95%CRMP1 antibody
CRMP1 antibody was raised using the N terminal of CRMP1 corresponding to a region with amino acids MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIDegré de pureté :Min. 95%S100B antibody
The S100B antibody is an acidic monoclonal antibody that acts as an inhibitor of various proteins and enzymes. It has been shown to inhibit the activity of liver microsomes, oncostatin, and histone H3 in Life Sciences research. This antibody specifically targets the S100B antigen and has been found to modulate dopamine and tyrosine metabolism. Additionally, it has been shown to affect the expression of β-catenin and exhibit anti-glial fibrillary properties. The S100B antibody is a valuable tool in research and diagnostics for studying various cellular processes and pathways involving these proteins.PLK1 antibody
The PLK1 antibody is a monoclonal antibody that targets the amino-terminal region of PLK1, a protein involved in various cellular processes. This antibody is widely used in life sciences research to study the role of PLK1 in cell growth and division. It has been shown to inhibit the activity of PLK1, leading to reduced proliferation and increased apoptosis in cancer cells. Additionally, this antibody has been found to decrease microvessel density and inhibit angiogenesis, making it a potential therapeutic target for cancer treatment. The PLK1 antibody has high affinity and specificity for its target, ensuring accurate and reliable results in experiments. It can be used in various techniques such as immunohistochemistry, Western blotting, and flow cytometry. With its ability to neutralize PLK1 activity, this antibody holds great promise for advancing our understanding of cellular processes and developing novel therapeutic strategies.RPSA antibody
RPSA antibody was raised using the middle region of RPSA corresponding to a region with amino acids TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYDegré de pureté :Min. 95%Peptidase D antibody
Peptidase D antibody was raised using the middle region of PEPD corresponding to a region with amino acids LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVMIF4GD antibody
MIF4GD antibody was raised using the C terminal of MIF4GD corresponding to a region with amino acids LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSDRON antibody
The RON antibody is a polyclonal antibody that targets the growth factor receptor known as RON. It is also available in monoclonal form. This antibody binds to RON and can be used for various applications, including research and diagnostic purposes. RON is a receptor tyrosine kinase that plays a role in cell proliferation, migration, and survival. The binding of the RON antibody to this receptor can inhibit its activity, making it useful for studying the function of RON and its signaling pathways. Additionally, the RON antibody can be used as a therapeutic agent by blocking the interaction between RON and its ligands, potentially preventing or treating diseases associated with aberrant RON signaling.HRS antibody
The HRS antibody is a highly specialized product in the field of Life Sciences. It is widely used in research and diagnostic applications. This antibody is produced using mass spectrometric methods, ensuring its purity and quality.Amphetamine antibody
The Amphetamine antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and interacts with amphetamine, a powerful stimulant drug. This antibody has been extensively studied for its potential in inhibiting the growth and proliferation of hepatocytes and endothelial cells. Additionally, it has shown promising results in combination with other antibodies, such as trastuzumab, for targeting specific growth factors involved in various diseases. The Amphetamine antibody has been found to bind to proteins like collagen, β-catenin, fibronectin, and VEGF-C, which are crucial for cell growth and development. Its anti-her2 antibody properties make it a valuable tool in research and therapeutic applications.Degré de pureté :>90%Bcl6 antibody
The Bcl6 antibody is a highly specialized monoclonal antibody that targets the Bcl6 protein. This protein plays a crucial role in regulating the immune response and is activated in certain diseases, such as lymphoma. The Bcl6 antibody binds specifically to the Bcl6 protein, blocking its activity and preventing it from promoting cell growth and survival.
HSD17B1 antibody
HSD17B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAALRRC6 antibody
LRRC6 antibody was raised using the N terminal of LRRC6 corresponding to a region with amino acids LNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFL
