Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
CHMP4B antibody
CHMP4B antibody was raised using the middle region of CHMP4B corresponding to a region with amino acids RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHCD43 antibody
The CD43 antibody is a highly specific monoclonal antibody that is used in various applications in the field of life sciences. This antibody specifically targets CD43, a cell surface glycoprotein that is expressed on adipose tissue, liver microsomes, and other cell types. CD43 plays a crucial role in cell adhesion and signaling processes.Influenza B antibody
The Influenza B antibody is a monoclonal antibody that specifically targets the Influenza B virus. This antibody has been extensively studied and shown to have a high affinity for the virus, making it an effective tool for diagnostic assays and research purposes. It can be used in various applications, including the detection of Influenza B virus in patient samples, the quantification of viral load, and the characterization of viral strains. Additionally, this antibody has been used in studies investigating autoantibodies and their role in disease pathogenesis. Its specificity ensures accurate and reliable results, making it an essential component in the field of Life Sciences. With its exceptional binding properties and compatibility with different assay formats, this Influenza B antibody is a valuable tool for researchers working on understanding and combating influenza infections.FKHR antibody
FKHR antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the FKHR protein, which plays a crucial role in various cellular processes. This antibody is commonly used in studies related to tgf-beta1 signaling, ketamine-induced neurotoxicity, erythropoietin receptor expression, and erythropoietin signaling pathways. The FKHR antibody has been validated for use in multiple applications, including Western blotting, immunohistochemistry, and immunofluorescence. It is derived from human serum and has been purified and buffered for optimal performance. This high-quality antibody offers reliable and consistent results, making it an essential tool for researchers studying FKHR and its associated pathways.PNRC2 antibody
PNRC2 antibody was raised using the middle region of PNRC2 corresponding to a region with amino acids NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFNRLBP1 antibody
The RLBP1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize RLBP1, a protein involved in various cellular processes. This antibody is commonly used in research and diagnostic applications, particularly in the detection and quantification of RLBP1 in human serum samples.SUOX antibody
The SUOX antibody is a monoclonal antibody used in the field of Life Sciences. It is designed to target and activate specific proteins involved in various biological processes. This antibody has shown promising results in the activation of fibrinogen, lipoprotein lipase, epidermal growth factor, and phosphatase. Additionally, it has been observed to have an effect on collagen and annexin. The SUOX antibody can be utilized as a medicament for therapeutic purposes, potentially offering new treatment options in the medical field.
Estrogen Receptor antibody
Estrogen Receptor antibody was raised in Mouse using a purified recombinant fragment of Estrogen Receptor(aa130-339) expressed in E. coli as the immunogen.
ACP6 antibody
ACP6 antibody was raised using the N terminal of ACP6 corresponding to a region with amino acids EQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFA
PE2 antibody
The PE2 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to a protein known as PE2, which plays a crucial role in various cellular processes. The PE2 antibody has been extensively tested and validated for its specificity and sensitivity.TRDMT1 antibody
TRDMT1 antibody was raised using the N terminal of TRDMT1 corresponding to a region with amino acids MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENVCD335 antibody
The CD335 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the CD335 protein, also known as NKp46. This protein is expressed on natural killer (NK) cells and plays a crucial role in their function. The CD335 antibody can be used to detect and quantify the expression of CD335 on various cell types, including human serum samples.SNRPA antibody
SNRPA antibody was raised using the middle region of SNRPA corresponding to a region with amino acids MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPTCH1 antibody
PTCH1 antibody is a highly specialized monoclonal antibody that plays a crucial role in regulating cell growth and development. It specifically targets the PTCH1 protein, which is involved in the Hedgehog signaling pathway. By binding to PTCH1, this antibody neutralizes its activity, preventing the activation of downstream factors that promote cell proliferation.PHACTR1 antibody
PHACTR1 antibody was raised using the middle region of PHACTR1 corresponding to a region with amino acids QRPTAEELEQRNILKPRNEQEEQEEKREIKRRLTRKLSQRPTVEELRERKHOXA1 antibody
The HOXA1 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to HOXA1, a protein involved in various cellular processes. This antibody has been extensively tested and proven to be nephrotoxic, making it an ideal tool for studying kidney-related diseases and functions.
C2ORF55 antibody
C2ORF55 antibody was raised using the middle region of C2Orf55 corresponding to a region with amino acids ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF
RECQL4 antibody
The RECQL4 antibody is a highly specialized monoclonal antibody that targets the RECQL4 protein. This protein plays a crucial role in DNA repair and maintenance, making it an essential component of cellular health. The RECQL4 antibody specifically recognizes and binds to the RECQL4 protein, activating its function and promoting efficient DNA repair processes.RPS6KB1 antibody
RPS6KB1 antibody was raised using the N terminal of RPS6KB1 corresponding to a region with amino acids MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLCD20 antibody
CD20 antibody is a monoclonal antibody that specifically targets CD20, a protein found on the surface of B cells. This antibody is designed to neutralize CD20, preventing it from functioning properly. CD20 antibodies have been widely used in the field of Life Sciences for various applications. They can be used as research tools to study B cell function and development, as well as in diagnostic tests to identify and classify different types of B cell lymphomas.CREBBP antibody
CREBBP antibody was raised using a synthetic peptide corresponding to a region with amino acids TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS
PARP12 antibody
PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSLRNF20 antibody
RNF20 antibody was raised using the middle region of RNF20 corresponding to a region with amino acids KEREREREREKEKEREREKQKLKESEKERDSAKDKEKGKHDDGRKKEAEINSMCE2 antibody
NSMCE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEPAWR antibody
The PAWR antibody is a highly specialized product in the field of Life Sciences. It is an antibody specifically designed for the detection and analysis of pluripotent stem cells. Pluripotent stem cells are unique cells with the ability to differentiate into any type of cell in the human body, making them extremely valuable for scientific research and medical applications.
alpha Crystallin A antibody
alpha Crystallin A antibody was raised in mouse using recombinant human Crystallin alpha A (1-173aa) purified from E. coli as the immunogen.SHC antibody
The SHC antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets tyrosine residues and plays a crucial role in signal transduction pathways. The SHC antibody is known to interact with various proteins, including TNF-related apoptosis-inducing ligand (TRAIL), protein kinases, phosphatases, and fibrinogen. This antibody has been extensively studied for its potential therapeutic applications, such as in the development of targeted cancer therapies. It has also been used in the study of angiogenesis and microvessel density, as well as growth factor signaling pathways. Researchers rely on the high specificity and sensitivity of the SHC antibody to gain insights into complex cellular processes and advance scientific understanding.MTHFS antibody
MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY
FBXO42 antibody
FBXO42 antibody was raised using the middle region of FBXO42 corresponding to a region with amino acids RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLSARP3 antibody
The ARP3 antibody is a highly specialized monoclonal antibody that targets extracellular histones. Histones play a crucial role in regulating gene expression through acetylation and other modifications. This antibody specifically binds to histones, inhibiting their activity and preventing them from interacting with other cellular components.
DHX9 antibody
DHX9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKACAD10 antibody
The ACAD10 antibody is a highly specialized product in the field of Life Sciences. It serves as a serum marker and biochemical tool for various research applications, particularly in the study of pluripotent stem cells. This antibody specifically targets mesothelin, a glycoprotein that plays a crucial role in cell signaling and differentiation.
Myeloperoxidase antibody
Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.PTS antibody
The PTS antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target specific proteins and molecules involved in various biological processes. This antibody can be used in research settings to study the role of these proteins and their interactions with other molecules.LYSMD1 antibody
LYSMD1 antibody was raised using the N terminal of LYSMD1 corresponding to a region with amino acids VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI14-3-3 theta antibody
The 14-3-3 theta antibody is an essential tool in Life Sciences research. It is a high-quality antibody that specifically targets the 14-3-3 theta protein. This protein plays a crucial role in various cellular processes, including signal transduction, cell cycle regulation, and apoptosis.CDC5L antibody
CDC5L antibody was raised in mouse using recombinant Human Cdc5 Cell Division Cycle 5-Like (S. Pombe) (Cdc5L)PEX5 antibody
The PEX5 antibody is a monoclonal antibody that has been specifically designed to target and neutralize the activity of PEX5, a protein involved in various cellular processes. This antibody is activated and reactive, making it highly effective in inhibiting the function of PEX5.MIA antibody
The MIA antibody is a polyclonal antibody that specifically targets annexin A2. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. The MIA antibody has shown high affinity and specificity towards its target, making it a valuable tool in studying the role of annexin A2 in different biological processes.
COG4 antibody
COG4 antibody was raised using the middle region of COG4 corresponding to a region with amino acids LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ
C1ORF43 antibody
C1ORF43 antibody was raised using the middle region of C1Orf43 corresponding to a region with amino acids YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQFGF21 antibody
The FGF21 antibody is a cytotoxic monoclonal antibody that targets the surface glycoprotein and is used in immunoassays. It has been shown to have potential therapeutic applications in Life Sciences, particularly in the field of gluconeogenesis regulation. The FGF21 antibody can be used as a treatment option in combination with high-dose chemotherapy or multiagent chemotherapy, and it has also shown promise when combined with histone deacetylase inhibitors. Additionally, this antibody exhibits natriuretic and growth factor properties, making it a versatile tool in various research and clinical settings.
NR5A1 antibody
NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids LQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA
